LRR_BACT_20 - 9 results ( vs nr cutoff 17.0 )
Results for LRR_BACT_20 ( vs nr cutoff 17.0 ) - 9 sequences found
Score min : Score max :
Number of matches to display :
Display sequences :
with length of insertions only
with sequences of insertions
Sort by:
G
A
V
L
S
I
Y
M
W
F
N
T
H
Q
K
R
D
E
C
P
Search
Prot_ID Score DB_type Select Protein Sequence
LRR_BACT_20 SNNQLTELPELPPNLEYLNVSNNQLTELPELPPNLEYLNVSNNQLTELPELPPNLEYLNV
5159158651591586|emb|CAF25390.1 | yopM; putative targeted effector protein [Yersinia pseudotuberculosis IP 32953]
51593889|ref|YP_068456.1| yopM; putative targeted effector protein [Yersinia pseudotuberculosis IP 32953]
1591 emb SCNSLTELPELPQSLKSLQVENNNLKALPDLPPSLKKLHVRENDLTDLPELPQSLESLRV
5159158651591586|emb|CAF25390.1 | yopM; putative targeted effector protein [Yersinia pseudotuberculosis IP 32953]
51593889|ref|YP_068456.1| yopM; putative targeted effector protein [Yersinia pseudotuberculosis IP 32953]
1556 emb DNNLLETLPDLPPSLKKLHVRENDLTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTA
7431184674311846|ref|YP_310265.1 | invasion plasmid antigen [Shigella sonnei Ss046]
73855323|gb|AAZ88030.1| invasion plasmid antigen [Shigella sonnei Ss046]
1554 ref DNNQLTMLPELPALLEYINADNNQLTMLPELPTSLEVLSVRNNQLTFLPELPESLEALDV
8277723882777238|ref|YP_403587.1 | invasion plasmid antigen [Shigella dysenteriae Sd197]
81241386|gb|ABB62096.1| invasion plasmid antigen [Shigella dysenteriae Sd197]
1554 ref DNNQLTMLPELPALLEYINADNNQLTMLPELPTSLEVLSVRNNQLTFLPELPESLEALDV
8254376582543765|ref|YP_407712.1 | invasion plasmid antigen [Shigella boydii Sb227]
81245176|gb|ABB65884.1| invasion plasmid antigen [Shigella boydii Sb227]
1554 ref DNNQLTMLPELPALLEYINADNNQLTMLPELPTSLEVLSVRNNQLTFLPELPESLEALDV
2405169624051696|gb|AAN42986.1 | invasion plasmid antigen [Shigella flexneri 2a str. 301]
24112769|ref|NP_707279.1| invasion plasmid antigen [Shigella flexneri 2a str. 301]
1554 gb DNNQLTMLPELPALLEYINADNNQLTMLPELPTSLEVLSVRNNQLTFLPELPESLEALDV
7431264674312646|ref|YP_311065.1 | invasion plasmid antigen [Shigella sonnei Ss046]
73856123|gb|AAZ88830.1| invasion plasmid antigen [Shigella sonnei Ss046]
1544 ref SNNQLSMLPELPRALKELNASSNQLSALPELPVSLEYINVSDNHLFALPELPASLEYINV
8254356282543562|ref|YP_407509.1 | invasion plasmid antigen [Shigella boydii Sb227]
82543497|ref|YP_407444.1| invasion plasmid antigen [Shigella boydii Sb227]
81244973|gb|ABB65681.1| invasion plasmid antigen [Shigella boydii Sb227]
81244908|gb|ABB65616.1| invasion plasmid antigen [Shigella boydii Sb227]
1544 ref SNNQLSMLPELPRALKELNASSNQLSALPELPVSLEYINVSDNHLFALPELPASLEYINV
3004166430041664|gb|AAP17392.1 | invasion plasmid antigen [Shigella flexneri 2a str. 2457T]
30063412|ref|NP_837583.1| invasion plasmid antigen [Shigella flexneri 2a str. 2457T]
1544 gb SNNQLSMLPELPRALKELNASSNQLSALPELPVSLEYINVSDNHLFALPELPASLEYINV