1VH4_v5 - 2 results ( test )
Results for 1VH4_v5 ( test ) - 2 sequences found
Score min : Score max :
Number of matches to display :
Display sequences :
with length of insertions only
with sequences of insertions
Sort by:
G
A
V
L
S
I
Y
M
W
F
N
T
H
Q
K
R
D
E
C
P
Search
Prot_ID Score DB_type Select Protein Sequence
1VH4_v5 QSFAXYHTHIEVGNENANARMINYILXXN_____QSFAXYHTHIEVGNENANARMINYILXXNQSFAXYHTHIEVGNE_____NANARMINYILX
4088989940889899|pdb|1VH4 |B Chain B, Crystal Structure Of A Stabilizer Of Iron Transporter
40889898|pdb|1VH4|A Chain A, Crystal Structure Of A Stabilizer Of Iron Transporter
274 GAVLRHNTSTQLNGENSTLRINSLAMPVK_____NEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQH___2_KTDGQMTNNNLL
4088989940889899|pdb|1VH4 |B Chain B, Crystal Structure Of A Stabilizer Of Iron Transporter
40889898|pdb|1VH4|A Chain A, Crystal Structure Of A Stabilizer Of Iron Transporter
218 VNTAHYRHHLDLA-EGAEATVIEHFVSLN___2_RHFTGARFTINVA-ANAHLQHIKLAFENPLSHHFAHNDLLLA-E_____DATAFSHSFLLG