TPR_REPEAT - 109 results ( )
Results for TPR_REPEAT ( ) - 109 sequences found
Score min : Score max :
Number of matches to display :
Display sequences :
with length of insertions only
with sequences of insertions
Sort by:
G
A
V
L
S
I
Y
M
W
F
N
T
H
Q
K
R
D
E
C
P
Search
Prot_ID Score DB_type Select Protein Sequence
TPR_REPEAT AEAWYNLGQVYFKMGDYDEAIEYFQKALELDPNN
157879372157879372|pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
157879373|pdb|1NA3|B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
157879372157879372|pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
157879373|pdb|1NA3|B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
157879370157879370|pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
157879371|pdb|1NA0|B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
157879370157879370|pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
157879371|pdb|1NA0|B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
157879370157879370|pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
157879371|pdb|1NA0|B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
9327969093279690|pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form)
168177007|pdb|2HYZ|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Orthorombic Crystal Form)
561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
9327969093279690|pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form)
168177007|pdb|2HYZ|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Orthorombic Crystal Form)
561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
9327969093279690|pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form)
168177007|pdb|2HYZ|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Orthorombic Crystal Form)
561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
9327969093279690|pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form)
168177007|pdb|2HYZ|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Orthorombic Crystal Form)
561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
7810145778101457|pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
7810145778101457|pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
423 AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
9327894693278946|pdb|2BUG|A Chain A, Solution Structure Of The Tpr Domain From Protein Phosphatase 5 In Complex With Hsp90 Derived Peptide 336 AEELKTQANDYFKAKDYENAIKFYSQAIELNPSN
6168019861680198|pdb|1WAO|1 Chain 1, Pp5 Structure
61680199|pdb|1WAO|2 Chain 2, Pp5 Structure
61680200|pdb|1WAO|3 Chain 3, Pp5 Structure
61680201|pdb|1WAO|4 Chain 4, Pp5 Structure
336 AEELKTQANDYFKAKDYENAIKFYSQAIELNPSN
157829638157829638|pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 336 AEELKTQANDYFKAKDYENAIKFYSQAIELNPSN
157835846157835846|pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
157835847|pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
334 ADAFYNAGVTYAYKENREKALEMLDKAIDIQPDH
5696716256967162|pdb|1XNF|A Chain A, Crystal Structure Of E.Coli Tpr-Protein Nlpi
56967163|pdb|1XNF|B Chain B, Crystal Structure Of E.Coli Tpr-Protein Nlpi
319 PEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY
110590444110590444|pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70
110590445|pdb|2GW1|B Chain B, Crystal Structure Of The Yeast Tom70
316 SSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN
112491393112491393|pdb|2HO1|A Chain A, Functional Characterization Of Pseudomonas Aeruginosa Pilf
112491394|pdb|2HO1|B Chain B, Functional Characterization Of Pseudomonas Aeruginosa Pilf
307 RDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSS
110591426110591426|pdb|2FI7|A Chain A, Crystal Structure Of Pilf : Functional Implication In The Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
110591427|pdb|2FI7|B Chain B, Crystal Structure Of Pilf : Functional Implication In The Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
307 RDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSS
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
303 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF
146387287146387287|pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p
146387288|pdb|2J9Q|B Chain B, A Novel Conformation For The Tpr Domain Of Pex5p
300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
119389035119389035|pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389036|pdb|2C0M|B Chain B, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389037|pdb|2C0M|C Chain C, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389038|pdb|2C0M|F Chain F, Apo Form Of The Tpr Domain Of The Pex5p Receptor
300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
119389033119389033|pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
300 LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH
1208465012084650|pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
12084651|pdb|1FCH|B Chain B, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
169404570169404570|pdb|2PL2|A Chain A, Crystal Structure Of Ttc0263: A Thermophilic Tpr Protein In Thermus Thermophilus Hb27
169404571|pdb|2PL2|B Chain B, Crystal Structure Of Ttc0263: A Thermophilic Tpr Protein In Thermus Thermophilus Hb27
298 PEIRSALAELYLSMGRLDEALAQYAKALEQAPKD
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
291 ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
169404570169404570|pdb|2PL2|A Chain A, Crystal Structure Of Ttc0263: A Thermophilic Tpr Protein In Thermus Thermophilus Hb27
169404571|pdb|2PL2|B Chain B, Crystal Structure Of Ttc0263: A Thermophilic Tpr Protein In Thermus Thermophilus Hb27
282 EQNPLRLGVQLYALGRYDAALTLFERALKENPQD
5051334350513343|pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
50513344|pdb|1QZ2|B Chain B, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
50513345|pdb|1QZ2|C Chain C, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
282 EKGLFRRGEAHLAVNDFELARADFQKVLQLYPNN
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
279 AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTF
77669127766912|pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide
7766913|pdb|1ELW|B Chain B, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide
279 VNELKEKGNKALSVGNIDDALQCYSEAIKLDPHN
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
275 AVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHF
5051327050513270|pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain
50513271|pdb|1P5Q|B Chain B, Crystal Structure Of Fkbp52 C-Terminal Domain
50513272|pdb|1P5Q|C Chain C, Crystal Structure Of Fkbp52 C-Terminal Domain
270 EKGLSRRGEAHLAVNDFELARADFQKVLQLYPNN
2837349428373494|pdb|1KT0|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes 265 EKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQN
2837349528373495|pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes 265 EKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQN
157835846157835846|pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
157835847|pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
263 ATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMEN
146387287146387287|pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p
146387288|pdb|2J9Q|B Chain B, A Novel Conformation For The Tpr Domain Of Pex5p
263 YLLWNKLGATLANGNQSEEAVAAYRRALELQPGY
119389035119389035|pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389036|pdb|2C0M|B Chain B, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389037|pdb|2C0M|C Chain C, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389038|pdb|2C0M|F Chain F, Apo Form Of The Tpr Domain Of The Pex5p Receptor
263 YLLWNKLGATLANGNQSEEAVAAYRRALELQPGY
119389033119389033|pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 263 YLLWNKLGATLANGNQSEEAVAAYRRALELQPGY
77669107766910|pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd 263 ALKEKELGNDAYKKKDFDTALKHYDKAKELDPTN
1208465012084650|pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
12084651|pdb|1FCH|B Chain B, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
263 YLLWNKLGATLANGNQSEEAVAAYRRALELQPGY
118138347118138347|pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana 260 PKALFRRGKAKAELGQMDSARDDFRKAQKYAPDD
77669107766910|pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd 258 AKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTP
159794747159794747|pdb|2E2E|A Chain A, Tpr Domain Of Nrfg Mediates The Complex Formation Between Heme Lyase And Formate-Dependent Nitrite Reductase In Escherichia Coli O157:h7
159794748|pdb|2E2E|B Chain B, Tpr Domain Of Nrfg Mediates The Complex Formation Between Heme Lyase And Formate-Dependent Nitrite Reductase In Escherichia Coli O157:h7
256 SEQWALLGEYYLWQNDYSNSLLAYRQALQLRGEN
110590444110590444|pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70
110590445|pdb|2GW1|B Chain B, Crystal Structure Of The Yeast Tom70
248 ALALKDKGNQFFRNKKYDDAIKYYNWALELKEDP
110591426110591426|pdb|2FI7|A Chain A, Crystal Structure Of Pilf : Functional Implication In The Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
110591427|pdb|2FI7|B Chain B, Crystal Structure Of Pilf : Functional Implication In The Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
246 SRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQ
8819294088192940|pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain
88192941|pdb|2FBN|B Chain B, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain
246 VKALYKLGVANMYFGFLEEAKENLYKAASLNPNN
2837349428373494|pdb|1KT0|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes 245 LAAFLNLAMCYLKLREYTKAVECCDKALGLDSAN
2837349528373495|pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes 245 LAAFLNLAMCYLKLREYTKAVECCDKALGLDSAN
157835846157835846|pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
157835847|pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
244 GDLFYMLGTVLVKLEQPKLALPYLQRAVELNEND
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
243 IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL
112491393112491393|pdb|2HO1|A Chain A, Functional Characterization Of Pseudomonas Aeruginosa Pilf
112491394|pdb|2HO1|B Chain B, Functional Characterization Of Pseudomonas Aeruginosa Pilf
242 SRVFENLGLVSLQXKKPAQAKEYFEKSLRLNRNQ
110590444110590444|pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70
110590445|pdb|2GW1|B Chain B, Crystal Structure Of The Yeast Tom70
240 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDY
159164069159164069|pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 239 VKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKN
5655387156553871|pdb|1TJC|A Chain A, Crystal Structure Of Peptide-Substrate-Binding Domain Of Human Type I Collagen Prolyl 4-Hydroxylase
56553872|pdb|1TJC|B Chain B, Crystal Structure Of Peptide-Substrate-Binding Domain Of Human Type I Collagen Prolyl 4-Hydroxylase
238 VSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEH
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
236 PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH
8375450583754505|pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
83754506|pdb|2C2L|B Chain B, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
83754507|pdb|2C2L|C Chain C, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
83754508|pdb|2C2L|D Chain D, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
234 VKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQ
157835846157835846|pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
157835847|pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
232 AIPYINFANLLSSVNELERALAFYDKALELDSSA
8240738282407382|pdb|1WM5|A Chain A, Crystal Structure Of The N-Terminal Tpr Domain (1-203) Of P67phox 228 AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN
1151366211513662|pdb|1E96|B Chain B, Structure Of The RacP67PHOX COMPLEX 228 AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN
1471978114719781|pdb|1HH8|A Chain A, The Active N-Terminal Region Of P67phox: Structure At 1.8 Angstrom Resolution And Biochemical Characterizations Of The A128v Mutant Implicated In Chronic Granulomatous Disease 228 AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN
5696716256967162|pdb|1XNF|A Chain A, Crystal Structure Of E.Coli Tpr-Protein Nlpi
56967163|pdb|1XNF|B Chain B, Crystal Structure Of E.Coli Tpr-Protein Nlpi
227 AQLLYERGVLYDSLGLRALARNDFSQALAIRPDX
1427780914277809|pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form
14277815|pdb|1IIP|A Chain A, Bovine Cyclophilin 40, Tetragonal Form
223 TKALYRRAQGWQGLKEYDQALADLKKAQEIAPED
178847325178847325|pdb|2VKJ|A Chain A, Structure Of The Soluble Domain Of The Membrane Protein Tm1634 From Thermotoga Maritima
178847326|pdb|2VKJ|B Chain B, Structure Of The Soluble Domain Of The Membrane Protein Tm1634 From Thermotoga Maritima
178847328|pdb|2VKO|A Chain A, Structure Of The Soluble Domain Of The Membrane Protein Tm1634 From Thermotoga Maritima
178847329|pdb|2VKO|B Chain B, Structure Of The Soluble Domain Of The Membrane Protein Tm1634 From The
222 ARSLIAEGKDLFETANYGEALVFFEKALNLSDNE
146387287146387287|pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p
146387288|pdb|2J9Q|B Chain B, A Novel Conformation For The Tpr Domain Of Pex5p
222 MEAWQYLGTTQAENEQELLAISALRRCLELKPDN
119389035119389035|pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389036|pdb|2C0M|B Chain B, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389037|pdb|2C0M|C Chain C, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389038|pdb|2C0M|F Chain F, Apo Form Of The Tpr Domain Of The Pex5p Receptor
222 MEAWQYLGTTQAENEQELLAISALRRCLELKPDN
119389033119389033|pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 222 MEAWQYLGTTQAENEQELLAISALRRCLELKPDN
1208465012084650|pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
12084651|pdb|1FCH|B Chain B, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
222 MEAWQYLGTTQAENEQELLAISALRRCLELKPDN
9327894693278946|pdb|2BUG|A Chain A, Solution Structure Of The Tpr Domain From Protein Phosphatase 5 In Complex With Hsp90 Derived Peptide 218 IKGYYRRAASNMALGKFRAALRDYETVVKVKPHD
6168019861680198|pdb|1WAO|1 Chain 1, Pp5 Structure
61680199|pdb|1WAO|2 Chain 2, Pp5 Structure
61680200|pdb|1WAO|3 Chain 3, Pp5 Structure
61680201|pdb|1WAO|4 Chain 4, Pp5 Structure
218 IKGYYRRAASNMALGKFRAALRDYETVVKVKPHD
157829638157829638|pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 218 IKGYYRRAASNMALGKFRAALRDYETVVKVKPHD
4716849147168491|pdb|1OUV|A Chain A, Helicobacter Cysteine Rich Protein C (Hcpc) 215 PKELVGLGAKSYKEKDFTQAKKYFEKACDLKENS
5051334350513343|pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
50513344|pdb|1QZ2|B Chain B, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
50513345|pdb|1QZ2|C Chain C, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
209 LASHLNLAMCHLKLQAFSAAIESCNKALELDSNN
5051327050513270|pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain
50513271|pdb|1P5Q|B Chain B, Crystal Structure Of Fkbp52 C-Terminal Domain
50513272|pdb|1P5Q|C Chain C, Crystal Structure Of Fkbp52 C-Terminal Domain
209 LASHLNLAMCHLKLQAFSAAIESCNKALELDSNN
8819294088192940|pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain
88192941|pdb|2FBN|B Chain B, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain
206 ISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNN
5567058855670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670589|pdb|1W3B|B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
206 YCVRSDLGNLLKALGRLEEAKACYLKAIETQPNF
110590444110590444|pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70
110590445|pdb|2GW1|B Chain B, Crystal Structure Of The Yeast Tom70
202 VNSYIYMALIMADRNDSTEYYNYFDKALKLDSNN
1427780914277809|pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form
14277815|pdb|1IIP|A Chain A, Bovine Cyclophilin 40, Tetragonal Form
202 LSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSN
157835846157835846|pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
157835847|pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
199 TEARFQFGMCLANEGMLDEALSQFAAVTEQDPGH
5696716256967162|pdb|1XNF|A Chain A, Crystal Structure Of E.Coli Tpr-Protein Nlpi
56967163|pdb|1XNF|B Chain B, Crystal Structure Of E.Coli Tpr-Protein Nlpi
197 SETNFYLGKYYLSLGDLDSATALFKLAVANNVHN
8375450583754505|pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
83754506|pdb|2C2L|B Chain B, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
83754507|pdb|2C2L|C Chain C, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
83754508|pdb|2C2L|D Chain D, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase
196 AVYYTNRALCYLKMQQPEQALADCRRALELDGQS
5051334350513343|pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
50513344|pdb|1QZ2|B Chain B, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
50513345|pdb|1QZ2|C Chain C, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90
195 STIVKERGTVYFKEGKYKQALLQYKKIVSWLEYE
5051327050513270|pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain
50513271|pdb|1P5Q|B Chain B, Crystal Structure Of Fkbp52 C-Terminal Domain
50513272|pdb|1P5Q|C Chain C, Crystal Structure Of Fkbp52 C-Terminal Domain
195 STIVKERGTVYFKEGKYKQALLQYKKIVSWLEYE
77669127766912|pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide
7766913|pdb|1ELW|B Chain B, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide
195 HVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDW
169404570169404570|pdb|2PL2|A Chain A, Crystal Structure Of Ttc0263: A Thermophilic Tpr Protein In Thermus Thermophilus Hb27
169404571|pdb|2PL2|B Chain B, Crystal Structure Of Ttc0263: A Thermophilic Tpr Protein In Thermus Thermophilus Hb27
193 APLHLQRGLVYALLGERDKAEASLKQALALEDTP
146387287146387287|pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p
146387288|pdb|2J9Q|B Chain B, A Novel Conformation For The Tpr Domain Of Pex5p
193 IRSRYNLGISCINLGAHREAVEHFLEALNMQRKS
119389035119389035|pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389036|pdb|2C0M|B Chain B, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389037|pdb|2C0M|C Chain C, Apo Form Of The Tpr Domain Of The Pex5p Receptor
119389038|pdb|2C0M|F Chain F, Apo Form Of The Tpr Domain Of The Pex5p Receptor
193 IRSRYNLGISCINLGAHREAVEHFLEALNMQRKS
119389033119389033|pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 193 IRSRYNLGISCINLGAHREAVEHFLEALNMQRKS
1208465012084650|pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
12084651|pdb|1FCH|B Chain B, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5
193 IRSRYNLGISCINLGAHREAVEHFLEALNMQRKS
1427780914277809|pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form
14277815|pdb|1IIP|A Chain A, Bovine Cyclophilin 40, Tetragonal Form
186 SEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGS
6273862262738622|pdb|1YA0|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Smg7
62738623|pdb|1YA0|B Chain B, Crystal Structure Of The N-Terminal Domain Of Human Smg7
180 QHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSN
159162521159162521|pdb|1IYG|A Chain A, Solution Structure Of Rsgi Ruh-001, A Fis1p-Like And Cgi- 135 Homologous Domain From A Mouse Cdna 173 RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQN
4088930240889302|pdb|1PC2|A Chain A, Solution Structure Of Human Mitochondria Fission Protein Fis1 173 RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQN
4601497646014976|pdb|1NZN|A Chain A, Cytosolic Domain Of The Human Mitchondrial Fission Protein Fis1 Adopts A Tpr Fold 173 RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQN
8240738282407382|pdb|1WM5|A Chain A, Crystal Structure Of The N-Terminal Tpr Domain (1-203) Of P67phox 169 SRICFNIGCMYTILKNMTEAEKAFTRSINRDKHL
6168058661680586|pdb|1YC9|A Chain A, The Crystal Structure Of The Outer Membrane Protein Vcec From The Bacterial Pathogen Vibrio Cholerae At 1.8 Resolution 169 ANAYAELARLYANQETVHAALQVRNKTVELLEKR
1151366211513662|pdb|1E96|B Chain B, Structure Of The RacP67PHOX COMPLEX 169 SRICFNIGCMYTILKNMTEAEKAFTRSINRDKHL
1471978114719781|pdb|1HH8|A Chain A, The Active N-Terminal Region Of P67phox: Structure At 1.8 Angstrom Resolution And Biochemical Characterizations Of The A128v Mutant Implicated In Chronic Granulomatous Disease 169 SRICFNIGCMYTILKNMTEAEKAFTRSINRDKHL
157835846157835846|pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
157835847|pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide-Binding Site
167 --------------GDYEKAAEAFTKAIEENKED
110590444110590444|pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70
110590445|pdb|2GW1|B Chain B, Crystal Structure Of The Yeast Tom70
167 PEVPNFFAEILTDKNDFDKALKQYDLAIELENKL
158431042158431042|pdb|2V6Y|B Chain B, Structure Of The Mit Domain From A S. Solfataricus Vps4- Like Atpase 165 ARKYAILAVKADKEGKVDDAITYYKKAIEVLSQI
158431041158431041|pdb|2V6Y|A Chain A, Structure Of The Mit Domain From A S. Solfataricus Vps4- Like Atpase 165 ARKYAILAVKADKEGKVEDAITYYKKAIEVLSQI
159164069159164069|pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 162 VEQLRKEGNELFKCGDYGGALAAYTQALGLDATP
1378698713786987|pdb|1HXI|A Chain A, An Unexpected Extended Conformation For The Third Tpr Motif Of The Peroxin Pex5 From Trypanosoma Brucei 161 EEAWRSLGLTQAENEKDGLAIIALNHARXLDPKD
77669107766910|pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd 160 MTYITNQAAVYFEKGDYNKCRELCEKAIEVGREN
110590444110590444|pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70
110590445|pdb|2GW1|B Chain B, Crystal Structure Of The Yeast Tom70
159 EQAKIGLAQMKLQQEDIDEAITLFEESADLARTM
159163946159163946|pdb|2CTL|A Chain A, Solution Structure Of The 13th Kh Type I Domain From Human Vigilin 159 -------GSSGSSGEQEDRALRSFKLSVTVDPKY
159794747159794747|pdb|2E2E|A Chain A, Tpr Domain Of Nrfg Mediates The Complex Formation Between Heme Lyase And Formate-Dependent Nitrite Reductase In Escherichia Coli O157:h7
159794748|pdb|2E2E|B Chain B, Tpr Domain Of Nrfg Mediates The Complex Formation Between Heme Lyase And Formate-Dependent Nitrite Reductase In Escherichia Coli O157:h7
158 ITALMLLASDAFMQANYAQAIELWQKVMDLNSPR