TPR_REPEAT - 2156 results ( )
Results for TPR_REPEAT ( ) - 2156 sequences found
Score min : Score max :
Number of matches to display :
Display sequences :
with length of insertions only
with sequences of insertions
Sort by:
G
A
V
L
S
I
Y
M
W
F
N
T
H
Q
K
R
D
E
C
P
Search
Prot_ID Score DB_type Select Protein Sequence
TPR_REPEAT AEAWYNLGQVYFKMGDYDEAIEYFQKALELDPNN
7499709774997097|sp|Q54VG4.1|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein 446 GKAYTRMGSAYTSLGKFSEAMEAYNKAIELEPNN
146325019146325019|sp|Q8CGY8.2|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 423 AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
122142735122142735|sp|Q27HV0.1|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 423 AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
39141913914191|sp|P56558.1|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 423 AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
6806750968067509|sp|O15294.3|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 423 AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
134035048134035048|sp|Q8BRH0|TMTC3_MOUSE Transmembrane and TPR repeat-containing protein 3 398 ADLWYNLAIVYIELKEPNEALKNFNRALELNPKH
1223080112230801|sp|O67178|Y1088_AQUAE Uncharacterized protein aq_1088 395 VEILYNLGVLHLNKGELEKALDLFERALRLKPDF
123737973123737973|sp|Q2JJK6.1|YCF3_SYNJB Photosystem I assembly protein ycf3 394 SYILYNMGLIYQSNGELDKALEYYHQALELNPRL
123751805123751805|sp|Q2JUT9.1|YCF3_SYNJA Photosystem I assembly protein ycf3 394 SYILYNMGLIYQSNGELDKALEYYHQALELNPRL
28425832842583|sp|Q58350|Y940_METJA TPR repeat-containing protein MJ0940 394 ASLWYFKGKLYEKQNKFEEALKYYNKAIQLMPHH
8191283281912832|sp|Q80W98.1|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta (Beta-SGT) (Small glutamine-rich protein with tetratricopeptide repeats 2) 392 SKAYGRMGLALTAMNKFEEAVTSYQKALDLDPEN
5278341552783415|sp|Q8VD33.1|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta (Beta-SGT) 392 SKAYGRMGLALTAMNKFEEAVTSYQKALDLDPEN
4101810941018109|sp|Q96EQ0.1|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta (Beta-SGT) (Small glutamine-rich protein with tetratricopeptide repeats 2) 389 SKAYGRMGLALTALNKFEEAVTSYQKALDLDPEN
7531881875318818|sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (PhSPY) 384 AEAYNNLGVLYRDAGNISLAIEAYEQCLKIDPDS
7533064675330646|sp|Q8RVB2|SPY_LYCES Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (LeSPY) 384 AEAYNNLGVLYRDAGNISLAIEAYEQCLKIDPDS
3156325331563253|sp|Q8DIQ6|YCF3_SYNEL Photosystem I assembly protein ycf3 374 SYILYNIGLIHASNGEHEKALEYYHQALELNPRM
3708830237088302|sp|Q86TZ1|TTC6_HUMAN Tetratricopeptide repeat protein 6 (TPR repeat protein 6) 373 SLAYFNAGNIYFHHRQFSQASDYFSKALKFDPEN
172046711172046711|sp|Q3M690.2|YCF3_ANAVT Photosystem I assembly protein ycf3 371 GYILYNMGLIYASNGDHDKALELYHQAIELNPRL
2136309221363092|sp|Q8YS98|YCF3_ANASP Photosystem I assembly protein ycf3 371 GYILYNMGLIYASNGDHDKALELYHQAIELNPRL
7532535375325353|sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 370 AEAYNNLGVLYRDAGSITSAVQAYEKCLQIDPDS
122146102122146102|sp|Q32LM2.1|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) 369 SKAYGRMGLALSSLNKHTEAVAYYRKALELDPDN
7475957974759579|sp|Q8IUR5|TMTC1_HUMAN Transmembrane and TPR repeat-containing protein 1 368 AEILSPLGALYYNTGRYEEALQIYQEAAALQPSQ
123788588123788588|sp|Q3UV71|TMTC1_MOUSE Transmembrane and TPR repeat-containing protein 1 368 AEVLSPLGALYYNTGRHKEALEVYREAVSLQPSQ
5278346052783460|sp|Q8NBP0|TTC13_HUMAN Tetratricopeptide repeat protein 13 (TPR repeat protein 13) 367 IDAYKSLGQAYRELGNFEAATESFQKALLLNQNH
122129653122129653|sp|Q7K4B6|TMTC3_DROME Transmembrane and TPR repeat-containing protein CG4050 366 ADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEH
1223080112230801|sp|O67178|Y1088_AQUAE Uncharacterized protein aq_1088 366 DALYARLGALYYSQGKLEEAQHYWERALSLNPNK
81346648134664|sp|O70593.1|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) (Small glutamine-rich protein with tetratricopeptide repeats 1) 366 SKAYGRMGLALSSLNKHAEAVAYYKKALELDPDN
4101801141018011|sp|Q8BJU0.2|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) 366 SKAYGRMGLALSSLNKHAEAVAYYKKALELDPDN
1264419812644198|sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog (CDC27Hs) (H-NUC) 365 YNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQS
7499670474996704|sp|Q54J83.1|APC3_DICDI Anaphase-promoting complex subunit 3 365 TPIYILLGKCYKQLGELDKALDSLNTALDLDPKN
5131681851316818|sp|Q85FT1|YCF3_CYAME Photosystem I assembly protein ycf3 364 SYIIYNIGLIYASNGEDEQALEYYHQALELNPRL
3311240133112401|sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase (O-GlcNAc) (OGT) 362 AEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEF
17094031709403|sp|P10505|APC3_SCHPO Anaphase-promoting complex subunit 3 (20S cyclosome/APC complex protein apc3) (Nuclear alteration protein 2) (Nuclear scaffold-like protein p76) 360 YNAWYGLGMVYLKTGRNDQADFHFQRAAEINPNN
4639602046396020|sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (MDj11) 359 AESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNN
7533292175332921|sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 359 AEAFNNLGVLYRDAGNITMAIDAYEECLKIDPDS
3134048431340484|sp|O60184.1|CYC8_SCHPO General transcriptional corepressor ssn6 357 PTFWCSIGVLYYQINQYQDALDAYSRAIRLNPYI
122145853122145853|sp|Q1JQ97|BBS4_BOVIN Bardet-Biedl syndrome 4 protein homolog 355 DLTYIMLGKIFLLKGDLDKAIEIYKKAVEFSPEN
3753779037537790|sp|Q8C1Z7|BBS4_MOUSE Bardet-Biedl syndrome 4 protein homolog 355 DLTYIMLGKIHLLQGDLDKAIEIYKKAVEFSPEN
39159523915952|sp|Q57711|Y941_METJA TPR repeat-containing protein MJ0941 355 VALWYFKGELYERLGKLDEALKCYEKVIELQPHY
731705731705|sp|P38825|YHR7_YEAST TPR repeat-containing protein YHR117W 354 PPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPEN
7533026675330266|sp|Q8LP10|SPY_EUSGR Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (EgSPY) 354 AEACNNLGVIYKDRDNLDKAVECYQKALSIKPNF
160359000160359000|sp|Q96RK4.2|BBS4_HUMAN Bardet-Biedl syndrome 4 protein 353 DLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPEN
7506176975061769|sp|Q5R8D8.1|DNJC7_PONAB DnaJ homolog subfamily C member 7 353 AETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKN
4639787946397879|sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) 353 AETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKN
11757021175702|sp|P42460|Y270_SYNP7 TPR repeat-containing protein Synpcc7942_0270 353 TVALTALGLAARAIGNYPEAIAAYQQALQLDPND
31833723183372|sp|Q58823|Y1428_METJA TPR repeat-containing protein MJ1428 352 SRWWYVKGYIYYKLGNYKDAYESFMNALRVNPKD
7533026675330266|sp|Q8LP10|SPY_EUSGR Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (EgSPY) 352 AEAYNNLGVLYRDAGNIFLAIEAYEQCLKIDPDS
81346668134666|sp|O43765.1|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) (Vpu-binding protein) (UBP) 351 SKAYGRMGLALSSLNKHVEAVAYYKKALELDPDN
8190935781909357|sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing protein 2 350 TSCLYNLGKLYHEQGRYEEALSVYREAIQKMPRH
7501602975016029|sp|Q8ILC1.1|STI1L_PLAF7 STI1-like protein 349 VKAYSRKGNLHFFMKDYYKALQAYNKGLELDPNN
584897584897|sp|P38042|CDC27_YEAST Anaphase-promoting complex subunit CDC27 (Cell division control protein 27) (Anaphase-promoting complex subunit 3) 349 YNAYYGLGTSAMKLGQYEEALLYFEKARSINPVN
7514895375148953|sp|Q84XU2.1|PPP5_ARATH Serine/threonine protein phosphatase 5 347 SKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPND
13517771351777|sp|P49525|YCF3_ODOSI Photosystem I assembly protein ycf3 346 SYTLYNIGLIYGNNGNYSQALEYYHQALELNSNL
7496085974960859|sp|O77033.1|CYC8_DICDI General transcriptional corepressor trfA 343 SEVWYDLGTLYESCHQHTDSLDAYQRAAELDPHN
7467620174676201|sp|O94474.1|SKI3_SCHPO Superkiller protein 3 342 TNAWSGLGEAYARSGRYVSALKAFNRASILDPDD
123770669123770669|sp|Q3AH18.1|YCF3_SYNSC Photosystem I assembly protein ycf3 342 SETLKNMAIIYMSNGEEERAIETYRKALEENPNQ
114987114987|sp|P17885|BIMA_EMENI Protein bimA 342 YNAWYGLGTVYDKMGKLDFAEQHFRNAAKINPSN
28335992833599|sp|Q58208|Y798_METJA TPR repeat-containing protein MJ0798 341 YKALFGLGKSYYLMSDNKNSIKYFEKVLELNPND
7531881875318818|sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (PhSPY) 340 AEAYCNMGVIYKNRGDLESAIACYERCLAVSPNF
7533608275336082|sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC (Protein SECRET AGENT) 340 PDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNS
7532535375325353|sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 339 AEAYCNMGVIYKNRGELEAAIACYERCLTISPNF
7475984374759843|sp|Q8N394|TMTC2_HUMAN Transmembrane and TPR repeat-containing protein 2 339 TSCLYNLGKLYHEQGHYEEALSVYKEAIQKMPRQ
28335992833599|sp|Q58208|Y798_METJA TPR repeat-containing protein MJ0798 338 IDLILKVAFTYFKLKKYKHALKYFEKALKLNPNV
465496465496|sp|P33746|SOLR_CLOAB Sol locus transcriptional repressor 338 NSVYRSLGITYAKIGDYKKSEEYLKKALDAEPEK
28425952842595|sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 338 PLLYLYKGIILNKLGKYNEAIKYFDKVLEINPNI
7502684175026841|sp|Q9VF81|TMTC4_DROME Transmembrane and TPR repeat-containing protein CG5038 337 AVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQ
7533292175332921|sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 336 AEAYCNMGVIYKNRGDLEMAITCYERCLAVSPNF
17097441709744|sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 (PP5) (Protein phosphatase T) (PP-T) (PPT) 336 AEELKTQANDYFKAKDYENAIKFYSQAIELNPSN
17097451709745|sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 (PP5) (Protein phosphatase T) (PPT) 336 AEELKTQANDYFKAKDYENAIKFYSQAIELNPSN
7496085974960859|sp|O77033.1|CYC8_DICDI General transcriptional corepressor trfA 336 PTFWCSIGVLYYQINQYRDALDAYTRAIRLNPFL
172046640172046640|sp|Q10W18.2|YCF3_TRIEI Photosystem I assembly protein ycf3 335 SYILYNIGLIHASNGEHDQALEYYHQALENNPRM
158564023158564023|sp|Q9H6T3.2|RPAP3_HUMAN RNA polymerase II-associated protein 3 334 TKAYSRRGAARFALQKLEEAKKDYERVLELEPNN
7533335375333353|sp|Q9C566.1|CYP40_ARATH Peptidyl-prolyl cis-trans isomerase CYP40 (PPIase CYP40) (Cyclophilin of 40 kDa) (Cyclophilin-40) (Rotamase CYP40) (Protein SQUINT) 334 VKALFRQGQAYMALNNVDAAAESLEKALQFEPND
2098171520981715|sp|P17883|SKI3_YEAST Superkiller protein 3 332 VESWVGLGQAYHACGRIEASIKVFDKAIQLRPSH
8191180581911805|sp|Q75Q39.1|TOM70_RAT Mitochondrial precursor proteins import receptor (Mitochondrial import receptor subunit TOM70) (Translocase of outer membrane 70 kDa subunit) 331 AQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTE
1428564414285644|sp|Q9CZW5.1|TOM70_MOUSE Mitochondrial precursor proteins import receptor (Mitochondrial import receptor subunit TOM70) (Translocase of outer membrane 70 kDa subunit) 331 AQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTE
1428564314285643|sp|O94826.1|TOM70_HUMAN Mitochondrial precursor proteins import receptor (Mitochondrial import receptor subunit TOM70) (Translocase of outer membrane 70 kDa subunit) 331 AQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTE
7531884775318847|sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (HvSPY) 331 AEAYCNMGVIYKNRGELDAAIACYDRCLTISPNF
8191707581917075|sp|Q9D706.1|RPAP3_MOUSE RNA polymerase II-associated protein 3 330 ALVLKEKGNKYFKQGKYDEAIECYTKGMDADPYN
8191076581910765|sp|Q68FQ7.1|RPAP3_RAT RNA polymerase II-associated protein 3 330 ALVLKEKGNKYFKQGKYDEAIECYTKGMDADPYN
5131678451316784|sp|Q7VE59|YCF3_PROMA Photosystem I assembly protein ycf3 329 GETLKNMAIIYMSNGDEDKALDTYQKALEQNPKQ
1072035510720355|sp|Q57105|Y298_BORBU TPR repeat-containing protein BB_0298 329 ARFFNLIGLEFFKLGQYGPAIEYFAKNLEINPNN
117936117936|sp|P14922.1|CYC8_YEAST General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8) 328 PIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYI
7531884775318847|sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (HvSPY) 328 AEAYNNLGVLYRDAGSITLSVQAYERCLQIDPDS
114987114987|sp|P17885|BIMA_EMENI Protein bimA 328 PEAWCAVGNSFSHQRDHDQALKCFKRATQLDPHF
7533608275336082|sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC (Protein SECRET AGENT) 328 AIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAF
8191715081917150|sp|Q9DAC7|TTC32_MOUSE Tetratricopeptide repeat protein 32 (TPR repeat protein 32) 327 EVPYYNRGLIRYRLGYFDEALEDFKKALDLNPGF
7514676175146761|sp|Q84K11.1|PPP5_SOLLC Serine/threonine protein phosphatase 5 (LePP5) 326 SKGYYRRGAAYLAMGKFKDALKDFQQVKKLCPND
25074742507474|sp|P33292|PEX5_PICPA Peroxisomal targeting signal receptor (Peroxisomal protein PAS8) (Peroxin-5) (PTS1 receptor) 326 ALNWNRLGAALANYNKPEEAVEAYSRALQLNPNF
6805311168053111|sp|Q6B8S3|YCF3_GRATL Photosystem I assembly protein ycf3 325 SYIIYNIGLIYASNGEHIKALEYYHQSLELNPRL
134975134975|sp|P15705|STI1_YEAST Heat shock protein STI1 325 SKGYNRLGAAHLGLGDLDEAESNYKKALELDASN
7533292175332921|sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 325 AEACNNLGVLYKDRDNLDKAVECYQMALSIKPNF
8186833081868330|sp|Q9ERU9|RBP2_MOUSE E3 SUMO-protein ligase RanBP2 (Ran-binding protein 2) 325 PKAHRFLGLLYEVEENIDKAVECYKRSVELNPTQ
7499649174996491|sp|Q54DA8.1|STIP1_DICDI Protein STIP1 homolog 325 ATEFKNQGNAAFSSKDYNSAVKCFDQAIELDPSN
122232146122232146|sp|Q1XDU6|YCF37_PORYE Uncharacterized protein ycf37 324 ANLYNMLGFIYFEAGQTSFAKNFYEQALQINPNY
13517761351776|sp|P48191|YCF3_CYAPA Photosystem I assembly protein ycf3 324 SYTFYNIALIHTSNGDQTKALEYYRQALDLNPKM
7486971074869710|sp|Q9VL78|FKB59_DROME FK506-binding protein 59 (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (dFKBP59) 324 VKALYRRGQCNLTINELEDALEDFQKVIQLEPGN
158514243158514243|sp|A5A6J9.1|IFIT3_PANTR Interferon-induced protein with tetratricopeptide repeats 3 (IFIT-3) 323 TDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNN
158564023158564023|sp|Q9H6T3.2|RPAP3_HUMAN RNA polymerase II-associated protein 3 323 ALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYN
7475833974758339|sp|Q6PGP7|TTC37_HUMAN Tetratricopeptide repeat protein 37 (TPR repeat protein 37) 323 AVAWTNLGVLYLTNENIEQAHEAFKMAQSLDPSY
7532535375325353|sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 323 AEACNNLGVIYKDRDNLDKAVECYQMALSIKPNF
68315706831570|sp|O14879|IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 (IFIT-3) (IFIT-4) (Interferon-induced 60 kDa protein) (IFI-60K) (ISG-60) (CIG49) (Retinoic acid-induced gene G protein) (RIG-G) 323 TDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNN
2014180420141804|sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 (PP5) (Protein phosphatase T) (PPT) 323 AEELKTQANDYFKAKDYENAIKFYSQAIELNPGN
24960492496049|sp|Q57992|Y572_METJA Uncharacterized protein MJ0572 323 AEYYYKKGVEVGNKGDVEKALEYFNKAIELNPFY
115908115908|sp|P09798|CDC16_YEAST Anaphase-promoting complex subunit CDC16 (Cell division control protein 16) 323 SEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNN
7531884775318847|sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (HvSPY) 323 AEACNNLGVIYKDRDNLDKAVECYQMALSIKPNF
8191707581917075|sp|Q9D706.1|RPAP3_MOUSE RNA polymerase II-associated protein 3 322 TKAYARRGAARFALQKLEDARKDYEKVLELEPDN
7531806175318061|sp|O23052.1|Y1515_ARATH Uncharacterized TPR repeat-containing protein At1g05150 322 VDALYNLGGLYMDLGRFQRASEMYTRVLTVWPNH
4101825741018257|sp|Q43468|STIP_SOYBN Heat shock protein STI (Stress-inducible protein) (GmSTI) 322 SKGYTRKGAVQFSMKEYDKALETYREGLKHDPNN
61366406136640|sp|O78490|YCF3_GUITH Photosystem I assembly protein ycf3 321 SYILYNIGLIYASNGEYVKALEYYHQALDLNSQL
28425952842595|sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 321 PDVYVRKARILRTLGENDKALEYFDKALKLKPKY
7499670474996704|sp|Q54J83.1|APC3_DICDI Anaphase-promoting complex subunit 3 321 PYSWVVVGNCFSLQRDHEAAIKLFRRAIQLDPDM
171769858171769858|sp|A2T334.1|YCF3_ANGEV Photosystem I assembly protein ycf3 320 SYILYNIGLIHTSNGEHAKALEYYSQALERNPSL
7516047475160474|sp|Q8S8L9.1|Y2245_ARATH Uncharacterized TPR repeat-containing protein At2g32450 320 VDALYNLGGLYMDLGRFQRASEMYTRVLAVWPNH
731705731705|sp|P38825|YHR7_YEAST TPR repeat-containing protein YHR117W 320 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNE
7533608275336082|sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC (Protein SECRET AGENT) 320 LEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNH
7533064675330646|sp|Q8RVB2|SPY_LYCES Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (LeSPY) 319 AEAYCNMGVIFKNRGDLESAIACYERCLAVSPNF
1264419812644198|sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog (CDC27Hs) (H-NUC) 319 AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRH
8402868484028684|sp|P0AFB1.1|NLPI_ECOLI Lipoprotein nlpI precursor
84028682|sp|P0AFB3|NLPI_ECO57 Lipoprotein nlpI precursor
84028683|sp|P0AFB2|NLPI_ECOL6 Lipoprotein nlpI precursor
84028685|sp|P0AFB4|NLPI_SHIFL Lipoprotein nlpI precursor
319 PEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY
134035048134035048|sp|Q8BRH0|TMTC3_MOUSE Transmembrane and TPR repeat-containing protein 3 318 AKLWNNVGHALENEKNFEKALKYFLQATHVQPDD
7475833974758339|sp|Q6PGP7|TTC37_HUMAN Tetratricopeptide repeat protein 37 (TPR repeat protein 37) 318 FNCWESLGEAYLSRGGYTTALKSFTKASELNPES
8330555483305554|sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 (Ran-binding protein 2) (Nuclear pore complex protein Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (p270) 318 PKAHRFLGLLYELEENTDKAVECYRRSVELNPTQ
7471738974717389|sp|Q99666.2|RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5 (Ran-binding protein 2-like 1) (RanBP2L1) (Sperm membrane protein BS-63) 318 PKAHRFLGLLYELEENTEKAVECYRRSVELNPTQ
7531881875318818|sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (PhSPY) 318 AEACNNLGVIYKDRDNLDKAVECYQMALTIKPNF
24967962496796|sp|Q04737|Y751_SYNY3 TPR repeat-containing protein slr0751 318 YKAYYNRANSYFQLGQYAQAIADYNRVLVLRPDY
7476137774761377|sp|Q9H0B2|RGPD7_HUMAN RANBP2-like and GRIP domain-containing protein 7 (RANBPL1 isoform 2) 318 PKAHRFLGLLYELEENTEKAVECYRRSVELNPTQ
7472680974726809|sp|Q53T03.1|RGPD6_HUMAN RANBP2-like and GRIP domain-containing protein 6 (Ran-binding protein 2-like 2) (RanBP2L2) 318 PKAHRFLGLLYELEENTEKAVECYRRSVELNPTQ
28516452851645|sp|P37650.2|BCSC_ECOLI Cellulose synthase operon protein C 318 SEALGALGQAYSQKGDRANAVANLEKALALDPHS
2200153722001537|sp|Q8X5M0|BCSC_ECO57 Cellulose synthase operon protein C 318 SEALGALGQAYSQKGDRANAVANLEKALALDPHS
7489700074897000|sp|Q54M21.1|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog precursor 318 ADALYNRAEAYMYEEDYQKALNDYNKAREHKPND
171473020171473020|sp|A0T0D3.1|YCF3_PHATR Photosystem I assembly protein ycf3 317 SYTLYNIGLIYGNTGKYTQALEFYHQALSLNANL
171473021171473021|sp|A0T0R5.1|YCF3_THAPS Photosystem I assembly protein ycf3 317 SYTLYNIGLIYAKNENYPRALEYYHQAVSLNSNL
190360183190360183|sp|A6NKT7.1|RGPD3_HUMAN RANBP2-like and GRIP domain-containing protein 3 316 PRAHRFLGLLYELEENTEKAVECYRRSVELNPTQ
166225161166225161|sp|Q7Z3J3.2|RGPD4_HUMAN RANBP2-like and GRIP domain-containing protein 4 316 PRAHRFLGLLYELEENTEKAVECYRRSVELNPTQ
122129653122129653|sp|Q7K4B6|TMTC3_DROME Transmembrane and TPR repeat-containing protein CG4050 316 AKLYNNVGHALENEGKFEEALLYFQQAVRIQTDD
17094621709462|sp|P07213|TOM70_YEAST Mitochondrial import receptor subunit TOM70 (70 kDa mitochondrial outer membrane protein) (Translocase of outer membrane 70 kDa subunit) 316 SSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN
172048717172048717|sp|A6MVX9.1|YCF3_RHDSA Photosystem I assembly protein ycf3 315 SYILYNIGLIYASNGEYIKALEYYHQALDLNSRL
172046628172046628|sp|Q3B045.2|YCF3_SYNS9 Photosystem I assembly protein ycf3 315 GETLKNMAIIYMSNGEEERAIETYQKALDENPKQ
7501357075013570|sp|Q86B11.1|CDC23_DICDI Anaphase-promoting complex subunit 8 (Cell division cycle protein 23 homolog) 315 LSAWTLIGHEFLEIKNVSAAINAYRKAVDINPRD
109892831109892831|sp|P0C1I1|PPID_RHIOR Peptidyl-prolyl cis-trans isomerase D (PPIase D) (Rotamase D) 314 TKAYFRRGSAKMNTRDFEGAIEDFEKAHEKDPED
8223585382235853|sp|Q6DFB8|TTC37_XENLA Tetratricopeptide repeat protein 37 (TPR repeat protein 37) 314 SNCWECLGEAYLSRGGYTTALKSFMKASELNPDS
3311240133112401|sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase (O-GlcNAc) (OGT) 314 ADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAF
464502464502|sp|P35056.1|PEX5_YEAST Peroxisomal targeting signal receptor (Peroxisomal protein PAS10) (Peroxin-5) (PTS1 receptor) 314 PEIQLCLGLLFYTKDDFDKTIDCFESALRVNPND
25013412501341|sp|Q01495|PEX5_PICAN Peroxisomal targeting signal receptor (Peroxisomal protein PAH2) (Peroxin-5) (PTS1 receptor) 314 ALAWNRLGASLANSNKPEQAIEAYSRTLQLNPNF
7485660274856602|sp|Q54Y27.1|FKBP6_DICDI FK506-binding protein 6 (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) 314 AKFYYRMGQAYSLNKQYDSAKRCLVQAIRLEPND
8223567682235676|sp|Q6DCD5|TMTC2_XENLA Transmembrane and TPR repeat-containing protein 2 313 TSCLYNLGKLYHEQGQYEDALIVYKEAIQKMPRQ
7470891174708911|sp|Q68DN6.1|RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 (Ran-binding protein 2-like 6) (RanBP2L6) 313 PRAHRFLGLLYELEENTEKAVECYRRSLELNPPQ
547644547644|sp|Q02508|HGV2_HALRO Protein HGV2 313 AETYYNLGLAYSFEKRYDNALEHYQSALDVLEAR
62253216225321|sp|Q14318.1|FKBP8_HUMAN FK506-binding protein 8 (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (38 kDa FK506-binding protein) (hFKBP38) (FKBPR38) 313 IKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN
1820234918202349|sp|P74063|YCF3_SYNY3 Photosystem I assembly protein ycf3 313 SYILYNMALIHASNGDHEKALGLYQEAIELNPKM
1362662213626622|sp|O35465.1|FKBP8_MOUSE FK506-binding protein 8 (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (38 kDa FK506-binding protein) (mFKBP38) (FKBPR38) 313 IKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN
134035047134035047|sp|Q6ZXV5|TMTC3_HUMAN Transmembrane and TPR repeat-containing protein 3 (Protein SMILE) 312 AKLWNNVGHALENEKNFERALKYFLQATHVQPDD
123031558123031558|sp|Q0I6Y9.1|YCF3_SYNS3 Photosystem I assembly protein ycf3 312 GETLKNIAIIYMSNGEEERALETYQKALDENPKQ
3134048431340484|sp|O60184.1|CYC8_SCHPO General transcriptional corepressor ssn6 312 LDIYFQIGHVYEQRKEYKLAKEAYERVLAETPNH
7533064675330646|sp|Q8RVB2|SPY_LYCES Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (LeSPY) 312 AEACNNLGVIYKDRDNLDKAVECYQLALSIKPNF
25013422501342|sp|Q99144|PEX5_YARLI Peroxisomal targeting signal receptor (Peroxisomal protein PAY32) (Peroxin-5) (PTS1 receptor) 312 ADVQVGLGVLFYGNEEYDKAIDCFNAAIAVRPDD
7475825874758258|sp|Q6P3X3|TTC27_HUMAN Tetratricopeptide repeat protein 27 (TPR repeat protein 27) 311 LGVWFSLGCAYLALEDYQGSAKAFQRCVTLEPDN
7502731975027319|sp|Q9VQE9|TMTC1_DROME Transmembrane and TPR repeat-containing protein CG31690 311 ADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQL
8223119082231190|sp|Q5F3K0|TTC27_CHICK Tetratricopeptide repeat protein 27 (TPR repeat protein 27) 311 LGVWFSLGCAYIALEGYEGAAKAFQRCVTLEPDN
7507081075070810|sp|Q5RBW9.1|TTC27_PONAB Tetratricopeptide repeat protein 27 (TPR repeat protein 27) 311 LGVWFSLGCAYLALEDYQGSAKAFQRCVTLEPDN
25074742507474|sp|P33292|PEX5_PICPA Peroxisomal targeting signal receptor (Peroxisomal protein PAS8) (Peroxin-5) (PTS1 receptor) 311 ADVQTGLGVLFYSMEEFDKTIDCFKAAIEVEPDK
28425952842595|sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 311 AIAWAEKGEILYREGKLKKSLECFDNALKINPKD
1264419812644198|sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog (CDC27Hs) (H-NUC) 311 PEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
160359000160359000|sp|Q96RK4.2|BBS4_HUMAN Bardet-Biedl syndrome 4 protein 310 TELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTN
68315716831571|sp|Q13325|IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 (IFIT-5) (Retinoic acid- and interferon-inducible 58 kDa protein) 310 VQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPEN
7489691874896918|sp|Q54IP0.1|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog 310 GKAYIRRAQCQMKQENYEDAVRDYEKAQSLDPEN
3993249539932495|sp|Q7NMQ0|YCF3_GLOVI Photosystem I assembly protein ycf3 309 AFAYYRDGMAAQADGDYAEALEYYNEALKLEEDA
117936117936|sp|P14922.1|CYC8_YEAST General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8) 309 PKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHF
3708830237088302|sp|Q86TZ1|TTC6_HUMAN Tetratricopeptide repeat protein 6 (TPR repeat protein 6) 309 AAVYFNRAHFYYCLKQYELAEEDLNKALSLKPND
171704563171704563|sp|A6YG60.1|YCF3_LEPTE Photosystem I assembly protein ycf3 308 SYIFYNIGLIHTSNGEHARALEYYYQALERNPSL
172048677172048677|sp|A6MM37.1|YCF3_BUXMI Photosystem I assembly protein ycf3 308 SYILYNIGLIHTSNGEHTKALEYYSRALERNPFL
8191308581913085|sp|Q8BG19|TMTC4_MOUSE Transmembrane and TPR repeat-containing protein 4 308 AKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKY
2200154022001540|sp|Q8ZLB8|BCSC_SALTY Cellulose synthase operon protein C 308 SEAVGALGQAYSQRGDRARAVAQFEKALAMAPHS
8191283281912832|sp|Q80W98.1|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta (Beta-SGT) (Small glutamine-rich protein with tetratricopeptide repeats 2) 307 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNN
4101810941018109|sp|Q96EQ0.1|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta (Beta-SGT) (Small glutamine-rich protein with tetratricopeptide repeats 2) 307 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNN
5278341552783415|sp|Q8VD33.1|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta (Beta-SGT) 307 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNN
584897584897|sp|P38042|CDC27_YEAST Anaphase-promoting complex subunit CDC27 (Cell division control protein 27) (Anaphase-promoting complex subunit 3) 307 PETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNF
114987114987|sp|P17885|BIMA_EMENI Protein bimA 307 ANVHYLLGKLYKMLRDKGNAIKHFTTALNLDPKA
166227565166227565|sp|A2BZV8.1|YCF3_PROM1 Photosystem I assembly protein ycf3 306 AYLYYRKGLAAQNDGDYSEALEYYEESLKLEDNQ
146325019146325019|sp|Q8CGY8.2|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 306 ADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAF
122142735122142735|sp|Q27HV0.1|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 306 ADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAF
123773727123773727|sp|Q46HP2.1|YCF3_PROMT Photosystem I assembly protein ycf3 306 AYLYYRKGLAAQNDGDYSEALEYYEESLKLEDNQ
7502624875026248|sp|Q9V3X5|TMTC2_DROME Transmembrane and TPR repeat-containing protein CG4341 306 SSAYLQLGALYVEQGKLQRALAIYREALSSLPGL
123910239123910239|sp|Q28G25|BBS4_XENTR Bardet-Biedl syndrome 4 protein homolog 306 TELLTTLGLLYLQNGLFQKAFEYLGNALTYDPSN
39141913914191|sp|P56558.1|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 306 ADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAF
3134048431340484|sp|O60184.1|CYC8_SCHPO General transcriptional corepressor ssn6 306 PKLWYGIGILYDRYGSHEHAEEAFMQCLRMDPNF
6806750968067509|sp|O15294.3|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 306 ADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAF
172045682172045682|sp|Q19V63.2|YCF3_CHLAT Photosystem I assembly protein ycf3 305 SYILYNIGLIHTSNGEHAKALEYYYQAIERNPSL
7475957974759579|sp|Q8IUR5|TMTC1_HUMAN Transmembrane and TPR repeat-containing protein 1 305 LECYRLLSAIYSKQENHDKALDAIDKALQLKPKD
7501602975016029|sp|Q8ILC1.1|STI1L_PLAF7 STI1-like protein 305 GDEHKLKGNEFYKQKKFDEALKEYEEAIQINPND
123770669123770669|sp|Q3AH18.1|YCF3_SYNSC Photosystem I assembly protein ycf3 305 AYVYYRDGLSAQNDGDYAEALENYEEALKLEENS
7475551874755518|sp|Q5I0X7|TTC32_HUMAN Tetratricopeptide repeat protein 32 (TPR repeat protein 32) 305 EVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGF
3311240133112401|sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase (O-GlcNAc) (OGT) 305 AVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNF
7496085974960859|sp|O77033.1|CYC8_DICDI General transcriptional corepressor trfA 305 AQTWYLLGRCYMTQQKYKKAYDAYQQAVYRDGRN
172048624172048624|sp|A6H5H4.1|YCF3_CYCTA Photosystem I assembly protein ycf3 304 SYILYNIGLIHMSNGEHTEALEYYFQALKRNPSL
123792576123792576|sp|Q0HA38|TT21B_MOUSE Tetratricopeptide repeat protein 21B (TPR repeat protein 21B) (Tetratricopeptide repeat-containing hedgehog modulator 1) 304 PRSFLLLGDAYMNIQEPEEAIVAYEQALNQNPKD
3753779037537790|sp|Q8C1Z7|BBS4_MOUSE Bardet-Biedl syndrome 4 protein homolog 304 TELLTTLGLLYLQLGVYQKAFEHLGNALTYDPAN
25013412501341|sp|Q01495|PEX5_PICAN Peroxisomal targeting signal receptor (Peroxisomal protein PAH2) (Peroxin-5) (PTS1 receptor) 304 SEVQTGLGVLFYSMEEYSKTLDCFQAAIEHNPND
125991255125991255|sp|Q32RL4|YCF3_ZYGCR Photosystem I assembly protein ycf3 303 SYILYNIGLIHTSNGEHAKAIEYYLQALERNPSL
122165179122165179|sp|Q06SJ8|YCF3_STIHE Photosystem I assembly protein ycf3 303 SYILYNIGLIHTSNGEHARALEYYYQALERNPSL
146325019146325019|sp|Q8CGY8.2|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 303 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF
122142735122142735|sp|Q27HV0.1|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 303 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF
8223397982233979|sp|Q5ZMQ9|PEX5_CHICK Peroxisomal targeting signal 1 receptor (Peroxisome receptor 1) (Peroxisomal C-terminal targeting signal import receptor) (PTS1-BP) (Peroxin-5) (PTS1 receptor) 303 PDVQCGLGVLFNLSGEYEKAVDCFSAALSVRPND
31833723183372|sp|Q58823|Y1428_METJA TPR repeat-containing protein MJ1428 303 LNALFKAGKIYLLFGDIDKAYDAFNEILQQNPSH
39141913914191|sp|P56558.1|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 303 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF
3993252839932528|sp|Q8BW49|TTC12_MOUSE Tetratricopeptide repeat protein 12 (TPR repeat protein 12) 303 TKAYFHMGKAHVALKNYSKAKECYQKIEEINPKL
6806750968067509|sp|O15294.3|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 303 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF
172044420172044420|sp|A4QM74.1|YCF3_PINKO Photosystem I assembly protein ycf3 302 SYILYNIGLVHTSNGEHTKALEYYFQALERNPSL
145558859145558859|sp|A1Z8E9|BBS4_DROME Bardet-Biedl syndrome 4 protein homolog 302 LESYVRLAELYRKDKQYQKAIEILENCLHLTPEN
17233601723360|sp|P52806|YCF3_PINTH Photosystem I assembly protein ycf3 302 SYILYNIGLVHTSNGEHTKALEYYFQALERNPSL
30250393025039|sp|P56311|YCF3_CHLVU Photosystem I assembly protein ycf3 302 SYILYNIGLIHTSNGDHARALDYYYQALERNPSL
172046711172046711|sp|Q3M690.2|YCF3_ANAVT Photosystem I assembly protein ycf3 301 AFVYYRDGMSAQAEGEYAEALEYYEEALTLEEDT
122222833122222833|sp|Q0P3N1|YCF3_OSTTA Photosystem I assembly protein ycf3 301 SFIFYNIGLIHTSNGEHTKALEYYYQALDRNPSL
123751805123751805|sp|Q2JUT9.1|YCF3_SYNJA Photosystem I assembly protein ycf3 301 AFAYYRDGMAAQSEGEYAEALENYREALALEQDD
2136309221363092|sp|Q8YS98|YCF3_ANASP Photosystem I assembly protein ycf3 301 AFVYYRDGMSAQAEGEYAEALEYYEEALTLEEDT
122248329122248329|sp|Q20ET3|YCF3_OLTVI Photosystem I assembly protein ycf3 300 SYILYNIGLIYTCNGEHGRALEYYYQALERNPSL
146325019146325019|sp|Q8CGY8.2|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 300 LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH
8190843281908432|sp|O70525|PEX5_CAVPO Peroxisomal targeting signal 1 receptor (Peroxisome receptor 1) (Peroxisomal C-terminal targeting signal import receptor) (PTS1-BP) (Peroxin-5) (PTS1 receptor) 300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
143811438143811438|sp|O09012|PEX5_MOUSE Peroxisomal targeting signal 1 receptor (Peroxisome receptor 1) (Peroxisomal C-terminal targeting signal import receptor) (PTS1-BP) (Peroxin-5) (PTS1 receptor) (PXR1P) (PTS1R) 300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
122142735122142735|sp|Q27HV0.1|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 300 LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH
8191632281916322|sp|Q920N5|PEX5_CRIGR Peroxisomal targeting signal 1 receptor (Peroxisome receptor 1) (Peroxisomal C-terminal targeting signal import receptor) (PTS1-BP) (Peroxin-5) (PTS1 receptor) 300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
39141913914191|sp|P56558.1|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 300 LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH
6806750968067509|sp|O15294.3|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 300 LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH
119364633119364633|sp|P50542|PEX5_HUMAN Peroxisomal targeting signal 1 receptor (Peroxisome receptor 1) (Peroxisomal C-terminal targeting signal import receptor) (PTS1-BP) (Peroxin-5) (PTS1 receptor) 300 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPND
7533608275336082|sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC (Protein SECRET AGENT) 300 AMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRF
7502684175026841|sp|Q9VF81|TMTC4_DROME Transmembrane and TPR repeat-containing protein CG5038 299 PAAWMNLGIVQSAQGKYDKALASYEKALKYRANF
1820345818203458|sp|Q9TL02|YCF3_NEPOL Photosystem I assembly protein ycf3 (RF3) 299 SYILYNIGLIHTSNGEHAKALEYYYQALERNPYL
66481056648105|sp|Q03560|YKD1_CAEEL TPR repeat-containing protein B0464.2 299 ADLRVGIGHCFAKMGMMDKAKTAFERAMEIEPYN
119390878119390878|sp|Q1RMV0|PEX5_BOVIN Peroxisomal targeting signal 1 receptor (Peroxisome receptor 1) (Peroxisomal C-terminal targeting signal import receptor) (PTS1-BP) (Peroxin-5) (PTS1 receptor) 298 PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPDD
122227276122227276|sp|Q4G394|YCF3_EMIHU Photosystem I assembly protein ycf3 298 SYILYNIGLIYGNNGDYSKSLDYYHQALDLNSRL
24967962496796|sp|Q04737|Y751_SYNY3 TPR repeat-containing protein slr0751 298 IPPYINRGNLYSQQQDHHTAIQDFTQAITYDPNR
1223082312230823|sp|Q9MUT7|YCF3_MESVI Photosystem I assembly protein ycf3 298 SYILYNIGLIHTSNGEHGKALEYYYQAIERNPSL
3134048431340484|sp|O60184.1|CYC8_SCHPO General transcriptional corepressor ssn6 298 AQSWYLIGRCYVAQQKYNKAYEAYQQAVYRDGRN
7466930874669308|sp|Q4WIF3|PPID_ASPFU Peptidyl-prolyl cis-trans isomerase D (PPIase D) (Rotamase D) 298 AKAYYRRAVAYSGQKEEDEALKDLQEALKLAPGD
134035049134035049|sp|Q5T4D3|TMTC4_HUMAN Transmembrane and TPR repeat-containing protein 4 297 AKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKY
122237374122237374|sp|Q1ACM4|YCF3_CHAVU Photosystem I assembly protein ycf3 297 SYILYNIGLIHTSNGEHAKALEYYFQALERNPSL
8190835081908350|sp|O35450|FKBPL_MOUSE FK506-binding protein-like 297 LKALYRRGVARAALGDLEKATADFKKVLAVDPKN
8223384982233849|sp|Q5ZKQ3.1|RPAP3_CHICK RNA polymerase II-associated protein 3 297 SKAFARRGAARVALGKLKEAMQDFEAVLKLEPGN
5131666551316665|sp|Q6YXP2|YCF3_PHYPA Photosystem I assembly protein ycf3 297 SYILYNIGLIHTSNGEHAKALEYYFQALERNPSL
2265419222654192|sp|Q8WI17|YCF3_PSINU Photosystem I assembly protein ycf3 297 SYILYNIGLIHTSNGEHAKALEYYFQALERNPSL
28425832842583|sp|Q58350|Y940_METJA TPR repeat-containing protein MJ0940 297 PVAYALLGQLYELLGNFDNALECYEKSLGIEEKF
2640156426401564|sp|O36033|YLM1_SCHPO TPR repeat-containing protein C19B12.01 297 YPTWFTYGCAALELQKYDAAMEAFSRCLSINPED
1831432918314329|sp|P12202|YCF3_MARPO Photosystem I assembly protein ycf3 297 SYILYNIGLIHTSNGEHAKALEYYFQALERNPSL
122231584122231584|sp|Q1KVR8|YCF3_SCEOB Photosystem I assembly protein ycf3 296 SYILYNIGLIHTSNGEHGRALEYYYQALERNPSL
7115352271153522|sp|Q96AY4|TTC28_HUMAN Tetratricopeptide repeat protein 28 (TPR repeat protein 28) 296 GRAYGNLGDCYEALGDYEEAIKYYEQYLSVAQSL
7115378971153789|sp|Q80XJ3|TTC28_MOUSE Tetratricopeptide repeat protein 28 (TPR repeat protein 28) 296 GRAYGNLGDCYEALGDYEEAIKYYEQYLSVAQSL
7531806175318061|sp|O23052.1|Y1515_ARATH Uncharacterized TPR repeat-containing protein At1g05150 296 ADAHCDLASSLHSMGEDERAIEVFQRAIDLKPGH
1820198018201980|sp|O20031|YCF3_CHLRE Photosystem I assembly protein ycf3 296 SYILYNIGLIHTSNGEHGRALEYYYQALERNPSL
123910239123910239|sp|Q28G25|BBS4_XENTR Bardet-Biedl syndrome 4 protein homolog 295 DLSAITLGKIQLQEGDIDGAIQTFTQALQLSPEN
123893483123893483|sp|Q28IV3.1|RPAP3_XENTR RNA polymerase II-associated protein 3 295 ALLEKEKGNNYFKSGQYDEAIECYTRGMDADPYN
61366186136618|sp|O78458|YCF37_GUITH Uncharacterized protein ycf37 295 ANLYNTIGFTYTQIAQYDLALFYYEKALLHEPNY
7499680274996802|sp|Q54MD1.1|PEX5_DICDI Peroxisomal targeting signal 1 receptor (PTS1 receptor) (Peroxin-5) 295 PEVQTALGLLYNMSYDYDKAVDCFKAALQNSPTD
7496085974960859|sp|O77033.1|CYC8_DICDI General transcriptional corepressor trfA 295 TEIYFRLGVLYKHQGKYDQSLEYFQHLVKNPPLP
8223719582237195|sp|Q6NU95.1|RPAP3_XENLA RNA polymerase II-associated protein 3 294 ALSEKEKGNNYFKSGKYDEAIECYTRGMDADPYN
7516047475160474|sp|Q8S8L9.1|Y2245_ARATH Uncharacterized TPR repeat-containing protein At2g32450 294 ADAHCDLASSLHAMGEDERAIEVFQRAIDLKPGH
7468866974688669|sp|Q6BM14|PEX5_DEBHA Peroxisomal targeting signal receptor (Peroxin-5) (PTS1 receptor) 294 PDVQMGLGVLFYANEDFDKTIDCFKAALSIKPDD
7533292175332921|sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 294 APAYYNLGVVYSEMMQYDNALSCYEKAALERPMY
8570038785700387|sp|O74711|PEX5_CANAL Peroxisomal targeting signal receptor (Peroxin-5) (PTS1 receptor) 294 ADVQMGLGVLFYANEEFDKTIDCFKAALSIRPDD
9314058393140583|sp|Q5ACI8|PPID_CANAL Peptidyl-prolyl cis-trans isomerase D (PPIase D) (Rotamase D) 293 TKALYRKGMGYILVKDEEQAQKILEEALELEPND
8224130782241307|sp|Q7ZU45|TTC25_BRARE Tetratricopeptide repeat protein 25 (TPR repeat protein 25) 293 FTTYMAEGDQLFQRGEYVKAVESFTTALTLQPDN
5278346752783467|sp|Q96AE7|TTC17_HUMAN Tetratricopeptide repeat protein 17 (TPR repeat protein 17) 293 AVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEF
7469032674690326|sp|Q6CT48|PEX5_KLULA Peroxisomal targeting signal receptor (Peroxin-5) (PTS1 receptor) 293 PEVQLGLGTLFYANEEFGKTIDCFRTALEVNPND
5131678451316784|sp|Q7VE59|YCF3_PROMA Photosystem I assembly protein ycf3 293 AYIYYREGFAAQNNGDYSEALENYEESLKLEENA
2640156426401564|sp|O36033|YLM1_SCHPO TPR repeat-containing protein C19B12.01 293 APAQRSLGKYYYKKGDLLQAMNCFNESLKINPLS
8191076581910765|sp|Q68FQ7.1|RPAP3_RAT RNA polymerase II-associated protein 3 292 TKAYARRGAARFALQKLEDARKDYVKVLELEPDN
7502624875026248|sp|Q9V3X5|TMTC2_DROME Transmembrane and TPR repeat-containing protein CG4341 292 PKALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNM
7502624875026248|sp|Q9V3X5|TMTC2_DROME Transmembrane and TPR repeat-containing protein CG4341 292 ADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNL
5131677451316774|sp|Q7V3E4|YCF3_PROMP Photosystem I assembly protein ycf3 292 GETLKNMAIIYMSNGEEDRSIETYQKALEENPKQ
2017804420178044|sp|P70962|RAPB_BACSU Response regulator aspartate phosphatase B (Stage 0 sporulation protein P) 292 GSALYNIGNCYDDKGELDQAAEYFEKALPVFEDY
117936117936|sp|P14922.1|CYC8_YEAST General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8) 292 AKALTSLAHLYRSRDMFQRAAELYERALLVNPEL
166227567166227567|sp|A5GP07.1|YCF3_SYNPW Photosystem I assembly protein ycf3 291 GETLKNMAIIYMSNGEEDRALATYQKALDENPKQ
9120816391208163|sp|Q62018|CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog (SH2 domain-binding protein 1) (Tetratricopeptide repeat-containing, SH2-binding phosphoprotein of 150 kDa) (TPR-containing, SH2-binding phosphoprotein of 150 kDa) (p150TSP) 291 VLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNN
8224938782249387|sp|Q4QR29|CTR9_XENLA RNA polymerase-associated protein CTR9 homolog (SH2 domain-binding protein 1) 291 VLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNN
146325019146325019|sp|Q8CGY8.2|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 291 ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
7475831874758318|sp|Q6PD62|CTR9_HUMAN RNA polymerase-associated protein CTR9 homolog (SH2 domain-binding protein 1) 291 VLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNN
122142735122142735|sp|Q27HV0.1|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 291 ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
8223582282235822|sp|Q6DEU9|CTR9_XENTR RNA polymerase-associated protein CTR9 homolog (SH2 domain-binding protein 1) 291 VLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNN
7469073974690739|sp|Q6FM42|PEX5_CANGA Peroxisomal targeting signal receptor (Peroxin-5) (PTS1 receptor) 291 ELMWNRLGASLANSNRSEEAIQAYHRALQLKPSF
7469073974690739|sp|Q6FM42|PEX5_CANGA Peroxisomal targeting signal receptor (Peroxin-5) (PTS1 receptor) 291 PDIQLCLGLLFYANDEFDRTIDCFQAALKVNPND
3311240133112401|sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase (O-GlcNAc) (OGT) 291 ADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDF
39141913914191|sp|P56558.1|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 291 ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
6806750968067509|sp|O15294.3|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-linked N-acetylglucosamine transferase 110 kDa subunit) (O-GlcNAc transferase subunit p110) 291 ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
464502464502|sp|P35056.1|PEX5_YEAST Peroxisomal targeting signal receptor (Peroxisomal protein PAS10) (Peroxin-5) (PTS1 receptor) 291 ELMWNRLGASLANSNRSEEAIQAYHRALQLKPSF
7499670474996704|sp|Q54J83.1|APC3_DICDI Anaphase-promoting complex subunit 3 291 YNAFYGIGLIYYRQEKYNLAEYHFRKALSINESS
152112334152112334|sp|Q8CD92|TTC27_MOUSE Tetratricopeptide repeat protein 27 (TPR repeat protein 27) 290 LGVWFSLGCAYLALEDYGGSAKAFQRCVTLEPDN
122166804122166804|sp|Q09X16|YCF3_MORIN Photosystem I assembly protein ycf3 290 SYILYNIGLIHTRNGEHTKALEYYFRALERNPFL
7531726475317264|sp|Q4VZH4|YCF3_CUCSA Photosystem I assembly protein ycf3 290 SYILYNIGLIHTRNGEHTKALEYYFRALERNPFL
116242522116242522|sp|P09914|IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 (IFIT-1) (Interferon-induced 56 kDa protein) (IFI-56K) 290 LESLSLLGFVYKLEGNMNEALEYYERALRLAADF
190358880190358880|sp|P19737.2|Y425_SYNP2 TPR repeat-containing protein SYNPCC7002_A0425 289 ARIHGALGYALSQLGNYSEAVTAYRRATELEDDN
7475957974759579|sp|Q8IUR5|TMTC1_HUMAN Transmembrane and TPR repeat-containing protein 1 289 AQAWMNMGGIQHIKGKYVSARAYYERALQLVPDS
7507601775076017|sp|Q4R5F5|IFIT1_MACFA Interferon-induced protein with tetratricopeptide repeats 1 (IFIT-1) 289 LESLSLLGFVYKLKGNMNEALEYYERALRLAADF
7362080973620809|sp|Q91YW3.1|DNJC3_MOUSE DnaJ homolog subfamily C member 3 precursor (Interferon-induced, double-stranded RNA-activated protein kinase inhibitor) (Protein kinase inhibitor of 58 kDa) (Protein kinase inhibitor p58) 289 TAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSE
7362080773620807|sp|Q13217.1|DNJC3_HUMAN DnaJ homolog subfamily C member 3 precursor (Interferon-induced, double-stranded RNA-activated protein kinase inhibitor) (Protein kinase inhibitor of 58 kDa) (Protein kinase inhibitor p58) 289 TAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSE
2500961025009610|sp|Q8M9W1|YCF3_CHAGL Photosystem I assembly protein ycf3 289 SYILYNIGLIHTSNGQHTKALEYYLQALERNPAL
7362080273620802|sp|Q27968.1|DNJC3_BOVIN DnaJ homolog subfamily C member 3 precursor (Interferon-induced, double-stranded RNA-activated protein kinase inhibitor) (Protein kinase inhibitor of 58 kDa) (Protein kinase inhibitor p58) 289 TAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSE
7533064675330646|sp|Q8RVB2|SPY_LYCES Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (LeSPY) 289 APAYYNLGVVYSEMMQYDMALNCYEKAALERPMY
7533608275336082|sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC (Protein SECRET AGENT) 289 ADAWSNLASAYMRKGRLSEATQCCQQALSLNPLL
134035338134035338|sp|Q49AM3|TTC31_HUMAN Tetratricopeptide repeat protein 31 (TPR repeat protein 31) 288 SQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQD
8218336282183362|sp|Q6DI40|TTC33_BRARE Tetratricopeptide repeat protein 33 (TPR repeat protein 33) 288 WEAWQTLGRAQLSLGEVELAVRSFQVALHLHPSE
117936117936|sp|P14922.1|CYC8_YEAST General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8) 288 ATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRN