TPR_REPEAT - 12552 results ( )
Results for TPR_REPEAT ( ) - 12552 sequences found
Score min : Score max :
Number of matches to display :
Display sequences :
with length of insertions only
with sequences of insertions
Sort by:
G
A
V
L
S
I
Y
M
W
F
N
T
H
Q
K
R
D
E
C
P
Search
Prot_ID Score DB_type Select Protein Sequence
TPR_REPEAT AEAWYNLGQVYFKMGDYDEAIEYFQKALELDPNN
3161565331615653|pdb|1NA3 |B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
31615652|pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
3161565331615653|pdb|1NA3 |B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
31615652|pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
3161565131615651|pdb|1NA0 |B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
31615650|pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
3161565131615651|pdb|1NA0 |B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
31615650|pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
3161565131615651|pdb|1NA0 |B Chain B, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
31615650|pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif
585 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN
9327969093279690|pdb|2FO7 |A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
9327969093279690|pdb|2FO7 |A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
9327969093279690|pdb|2FO7 |A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
9327969093279690|pdb|2FO7 |A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
7810145778101457|pdb|2AVP |A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
7810145778101457|pdb|2AVP |A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix 561 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
6681442466814424|ref|XP_641391.1 | hypothetical protein DDB0206532 [Dictyostelium discoideum]
60469405|gb|EAL67399.1| hypothetical protein DDBDRAFT_0206532 [Dictyostelium discoideum AX4]
446 ref GKAYTRMGSAYTSLGKFSEAMEAYNKAIELEPNN
6855015268550152|ref|ZP_00589606.1 | TPR repeat [Pelodictyon phaeoclathratiforme BU-1]
68242954|gb|EAN25161.1| TPR repeat [Pelodictyon phaeoclathratiforme BU-1]
442 ref VEIYCVLGDAYLDLGEYDKAKEAFEKALDLEPEN
9120119691201196|emb|CAJ74256.1 | hypothetical protein [Candidatus Kuenenia stuttgartiensis] 437 emb PDAYYNLGVAYSKKNQFDEAIQLLKKALEINPKD
9345474993454749|gb|EAT05007.1 | TPR repeat [delta proteobacterium MLMS-1]
94264810|ref|ZP_01288587.1| TPR repeat [delta proteobacterium MLMS-1]
434 gb VQAWTQLGHLYFDTDHYSQAIKAYQRSLQLEPDN
1971301619713016|gb|AAL93886.1 | Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
19705092|ref|NP_602587.1| Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
433 gb ASYYYKRGFSYYALNKYDKAIEDYNKAIKLDPNN
1567990215679902|ref|NP_275211.1 | TPR-repeat-containing protein [Methanothermobacter thermautotrophicus str. Delta H] 433 ref AEAWNNKGVVLSELGRYEEALECYEKALEIDPED
26211202621120|gb|AAB84589.1 | O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
15678111|ref|NP_275226.1| O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
433 gb AEAWNNKGVVLSELGRYEEALECYEKALEIDPED
5464539554645395|gb|EAL34135.1 | GA18656-PA [Drosophila pseudoobscura] 433 gb SKAYSRLGVAYSNMGKFNEAEQAYRKAIELEPEN
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 432 gb AVAYNNIGLVHFKQNKYDEAIQFYNKALEVDPNY
9345546293455462|gb|EAT05656.1 | TPR repeat [delta proteobacterium MLMS-1]
94264126|ref|ZP_01287924.1| TPR repeat [delta proteobacterium MLMS-1]
430 gb VQAWTQLGHLYFDTDHYSQAIKAYQRSLQLEPEN
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 427 gb VNSYIQLGNIYSEKASYEQAIEYFQKILEIEPNN
7239724172397241|gb|AAZ71514.1 | TPR repeat [Methanosarcina barkeri str. fusaro]
73670079|ref|YP_306094.1| TPR repeat [Methanosarcina barkeri str. fusaro]
426 gb ADAWFNKGNSFFSLKNYEEAIKAYDKAIELKPQN
2015158920151589|gb|AAM11154.1 | LD24721p [Drosophila melanogaster]
24584835|ref|NP_609842.1| small glutamine-rich tetratricopeptide containing protein CG5094-PA [Drosophila melanogaster]
7298392|gb|AAF53617.1| CG5094-PA [Drosophila melanogaster]
425 gb SKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDN
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 425 gb EIAYNNIGLIYYDQGKYDQALEQYNKALEINPKY
6792146967921469|ref|ZP_00514987.1 | TPR repeat:TPR repeat [Crocosphaera watsonii WH 8501]
67856581|gb|EAM51822.1| TPR repeat:TPR repeat [Crocosphaera watsonii WH 8501]
424 ref VEAYVNRGNVYLQLGEDEKAIADYEKALEINPND
7665927776659277|ref|XP_885067.1 | PREDICTED: similar to O-linked N-acetylglucosamine transferase isoform 9 [Bos taurus]
76659273|ref|XP_885017.1| PREDICTED: similar to O-linked N-acetylglucosamine transferase isoform 8 [Bos taurus]
74007674|ref|XP_858731.1| PREDICTED: similar to O-linked N-acetylglucosamine transferase isoform 6 [Canis familiaris]
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
2769445927694459|gb|AAH37194.1 | Ogt protein [Mus musculus] 423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
3230715032307150|ref|NP_858059.1 | O-linked GlcNAc transferase isoform 2 [Homo sapiens]
18250914|emb|CAC86127.1| UDP-N-acatylglucosamine: polypeptide-N-acetylglucosaminyl transferase [Homo sapiens]
15680175|gb|AAH14434.1| O-linked GlcNAc transferase, isoform 2 [Homo sapiens]
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5313112453131124|emb|CAG31793.1 | hypothetical protein [Gallus gallus] 423 emb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5572750255727502|emb|CAH90506.1 | hypothetical protein [Pongo pygmaeus] 423 emb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
3478571934785719|gb|AAH57319.1 | O-linked N-acetylglucosamine transferase [Mus musculus]
46909607|ref|NP_631883.2| O-linked N-acetylglucosamine transferase [Mus musculus]
423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
6679343966793439|ref|NP_001019747.1 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Xenopus tropicalis]
60618530|gb|AAH90599.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Xenopus tropicalis]
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
1377506613775066|gb|AAK39123.1 | UDP-N-acetylglucosaminyltransferase [Mus musculus] 423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5194998251949982|gb|AAH82353.1 | Ogt-prov protein [Xenopus laevis] 423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
3341725033417250|gb|AAH55851.1 | Ogt protein [Mus musculus]
26345360|dbj|BAC36331.1| unnamed protein product [Mus musculus]
423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
2749960627499606|gb|AAO17363.1 | O-linked GlcNAc transferase [Mus musculus] 423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665926776659267|ref|XP_884939.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 3 isoform 5 [Bos taurus]
10439643|dbj|BAB15537.1| unnamed protein product [Homo sapiens]
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
3366707733667077|ref|NP_058803.1 | O linked N-acetylglucosamine transferase [Rattus norvegicus]
1931579|gb|AAC53121.1| O-GlcNAc transferase, p110 subunit [Rattus norvegicus]
3914191|sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-GlcNAc transferase p110 subunit)
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
3230714832307148|ref|NP_858058.1 | O-linked GlcNAc transferase isoform 1 [Homo sapiens]
30268372|emb|CAD89970.1| hypothetical protein [Homo sapiens]
18250915|emb|CAC86128.1| UDP-N-acetylglucosamine: polypeptide-N-acetylglucosaminyl transferase [Homo sapiens]
68067509|sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (O-GlcNAc transferase p110 subunit)
23315618|gb|AAH38180.1| OGT protein [Homo
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5696737856967378|gb|AAW31873.1 | O-GlcNAc transferase variant 4 [Danio rerio]
66347879|ref|NP_001018117.1| O-linked N-acetylglucosamine transferase isoform 4 [Danio rerio]
423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5696737456967374|gb|AAW31871.1 | O-GlcNAc transferase variant 2 [Danio rerio]
66347873|ref|NP_001018115.1| O-linked N-acetylglucosamine transferase isoform 2 [Danio rerio]
423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5696737656967376|gb|AAW31872.1 | O-GlcNAc transferase variant 3 [Danio rerio]
66347871|ref|NP_001018116.1| O-linked N-acetylglucosamine transferase isoform 3 [Danio rerio]
423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5696737256967372|gb|AAW31870.1 | O-GlcNAc transferase variant 1 [Danio rerio]
62821820|ref|NP_001017359.1| O-linked N-acetylglucosamine transferase isoform 1 [Danio rerio]
423 gb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
4722294747222947|emb|CAF99103.1 | unnamed protein product [Tetraodon nigroviridis] 423 emb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665928576659285|ref|XP_885162.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 12 [Bos taurus] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665928376659283|ref|XP_885141.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 11 [Bos taurus] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665928176659281|ref|XP_610562.2 | PREDICTED: similar to O-linked GlcNAc transferase isoform 2 isoform 2 [Bos taurus] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665927976659279|ref|XP_885088.1 | PREDICTED: similar to O-linked N-acetylglucosamine transferase isoform 10 [Bos taurus] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665927576659275|ref|XP_872371.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 3 [Bos taurus] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665927176659271|ref|XP_884992.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 7 [Bos taurus] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665926976659269|ref|XP_884968.1 | PREDICTED: similar to O-linked N-acetylglucosamine transferase isoform 6 [Bos taurus]
74007672|ref|XP_858689.1| PREDICTED: similar to O-linked N-acetylglucosamine transferase isoform 5 [Canis familiaris]
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7665926576659265|ref|XP_884917.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 3 isoform 4 [Bos taurus] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7400768674007686|ref|XP_538075.2 | PREDICTED: similar to O-linked GlcNAc transferase isoform 2 isoform 1 [Canis familiaris] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7400768474007684|ref|XP_858918.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 11 [Canis familiaris] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7400768274007682|ref|XP_858881.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 10 [Canis familiaris] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7400768074007680|ref|XP_858842.1 | PREDICTED: similar to O-linked N-acetylglucosamine transferase isoform 9 [Canis familiaris] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7400767874007678|ref|XP_858808.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 8 [Canis familiaris] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7400767674007676|ref|XP_858769.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 7 [Canis familiaris] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7400767074007670|ref|XP_849392.1 | PREDICTED: similar to O-linked GlcNAc transferase isoform 1 isoform 2 [Canis familiaris] 423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
3187382531873825|emb|CAD97853.1 | hypothetical protein [Homo sapiens] 423 emb AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
6285796362857963|ref|NP_001015987.1 | O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) [Xenopus tropicalis]
89271320|emb|CAJ83290.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) [Xenopus tropicalis]
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
8988617389886173|ref|NP_001034837.1 | O-linked N-acetylglucosamine transferase [Sus scrofa]
89114276|gb|ABD61726.1| O-linked N-acetylglucosamine transferase [Sus scrofa]
423 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
7419446974194469|dbj|BAE37282.1 | unnamed protein product [Mus musculus] 423 dbj AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
5567058955670589|pdb|1W3B |B Chain B, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
55670588|pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha
423 AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDF
6855154868551548|ref|ZP_00590943.1 | TPR repeat [Prosthecochloris aestuarii DSM 271]
68241482|gb|EAN23748.1| TPR repeat [Prosthecochloris aestuarii DSM 271]
423 ref PEAYIKLGTAHARQEQYDAAIDAYEKALSLDPDS
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 419 gb KSAYIQLGNSYLDKVQYDQAIECYKKALEIDPND
6049258660492586|emb|CAH07358.1 | conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
52215805|dbj|BAD48398.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
53712940|ref|YP_098932.1| hypothetical protein BF1650 [Bacteroides fragilis YCH46]
60681152|ref|YP_211296.1| hypothetical protein BF1658 [Bacteroides fragilis NCTC 9343]
416 emb DEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDS
6792026267920262|ref|ZP_00513782.1 | TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
67857746|gb|EAM52985.1| TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
415 ref AFAYNNMGVALRKQGKYDEAIAAYKKAIEINPND
6792026267920262|ref|ZP_00513782.1 | TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
67857746|gb|EAM52985.1| TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
415 ref ATAYYNMGNALNRQGKLEEAIAAYKKAIELDPNY
8270115282701152|ref|YP_410718.1 | tetratricopeptide TPR_3 [Nitrosospira multiformis ATCC 25196]
82409217|gb|ABB73326.1| tetratricopeptide TPR_3 [Nitrosospira multiformis ATCC 25196]
415 ref ADAWHKLGMAYAHLKDYENASQAYEDAVRLDPDN
8585872485858724|ref|YP_460926.1 | tetratricopeptide repeat family protein [Syntrophus aciditrophicus SB]
85721815|gb|ABC76758.1| tetratricopeptide repeat family protein [Syntrophus aciditrophicus SB]
415 ref KDVHFTLGLLYYEQQRYDRAIEAFQKALKLAPSD
9120009891200098|emb|CAJ73141.1 | conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] 415 emb VPTYYNIGVAYNMMERFDEAIEAFKKVLNLDPEN
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 414 gb ANAYIKLGNIYLKQIKYEKARECYEKAIEIDPKQ
7167544071675440|ref|ZP_00673185.1 | TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71671556|gb|EAO28221.1| TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
413 ref AEAWHNLGLILRDKGQFEAAIEHYQKSLEIKPNN
9120049091200490|emb|CAJ73538.1 | similar to N-acetylglucosaminyltransferases (O-GlcNAc transferase) [Candidatus Kuenenia stuttgartiensis] 413 emb VNAYFNLGKTYKKLGRLDEAIAAFSKTIDIDPDD
6682530966825309|ref|XP_646009.1 | hypothetical protein DDB0201744 [Dictyostelium discoideum]
60474682|gb|EAL72619.1| hypothetical protein DDBDRAFT_0201744 [Dictyostelium discoideum AX4]
412 ref KDAYVALGAVYANTSQFEKAISNFKQALKIDPND
6787554367875543|ref|ZP_00504839.1 | TPR repeat [Clostridium thermocellum ATCC 27405]
67850574|gb|EAM46150.1| TPR repeat [Clostridium thermocellum ATCC 27405]
411 ref AEYYYNLGNAYLMINEFENAIESYNKAINLYPEY
7148222171482221|ref|ZP_00661919.1 | TPR repeat [Prosthecochloris vibrioformis DSM 265]
71282955|gb|EAO14786.1| TPR repeat [Prosthecochloris vibrioformis DSM 265]
411 ref VEAWCVLGDVYLDLGEYDDAKDAFMEALRLEPEN
6793622267936222|ref|ZP_00529233.1 | TPR repeat [Chlorobium phaeobacteroides DSM 266]
67774846|gb|EAM34521.1| TPR repeat [Chlorobium phaeobacteroides DSM 266]
410 ref ADAYSNRGNTLMKMNQYKEALESYERAIALKPEN
26211202621120|gb|AAB84589.1 | O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
15678111|ref|NP_275226.1| O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
409 gb ADAWYNKGSVLIYLKKYKKALKCFEKAIELNPKN
7167805071678050|ref|ZP_00675781.1 | TPR repeat [Trichodesmium erythraeum IMS101]
71668831|gb|EAO25510.1| TPR repeat [Trichodesmium erythraeum IMS101]
409 ref SYAYDALGTAYLYLNDIEEAEQKFKKALKLNPNN
9446921294469212|gb|ABF18455.1 | small glutamine-rich tetratricopeptide repeat (TPR)-containing protein [Aedes aegypti] 409 gb SKAYGRLGLAYSKMNKHEQALDAYQNALRIEPDN
8660898286608982|ref|YP_477744.1 | tetratricopeptide repeat/protein kinase domain protein [Synechococcus sp. JA-2-3B'a(2-13)]
86557524|gb|ABD02481.1| tetratricopeptide repeat/protein kinase domain protein [Synechococcus sp. JA-2-3B'a(2-13)]
409 ref AVAYYNRGNAYRQLNQQQQAIEDYSRAIELNPED
8860272488602724|ref|YP_502902.1 | Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
88188186|gb|ABD41183.1| Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
408 ref VNIWIMLGDTQIERGQYQEAIAAYEKALELDPEN
5523905955239059|gb|EAA44193.2 | ENSANGP00000022607 [Anopheles gambiae str. PEST]
58388490|ref|XP_316320.2| ENSANGP00000022607 [Anopheles gambiae str. PEST]
408 gb AEAYSNLGNVYKERGQLQEALENYRHAVRLKPDF
5523905855239058|gb|EAA10760.2 | ENSANGP00000020579 [Anopheles gambiae str. PEST]
58388488|ref|XP_316319.2| ENSANGP00000020579 [Anopheles gambiae str. PEST]
408 gb AEAYSNLGNVYKERGQLQEALENYRHAVRLKPDF
26211202621120|gb|AAB84589.1 | O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
15678111|ref|NP_275226.1| O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
408 gb AEAWNNKGLVLKELGRYDEALECYEKALKINPKY
7239724172397241|gb|AAZ71514.1 | TPR repeat [Methanosarcina barkeri str. fusaro]
73670079|ref|YP_306094.1| TPR repeat [Methanosarcina barkeri str. fusaro]
408 gb SSAWNNKGNALSSLGNYDEAIKAYDKAIEIDPQD
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 408 gb SEAYDKLGLVYEENEQFEEAIECYKKAIEHKPNN
4550123445501234|gb|AAH67176.1 | Small glutamine-rich tetratricopeptide repeat (TPR)-containing [Danio rerio]
47086521|ref|NP_997929.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing [Danio rerio]
407 gb SKAYGRMGLALASLNKYSEAVSYYKKALELDPDN
1432425714324257|dbj|BAB59185.1 | hypothetical protein [Thermoplasma volcanium GSS1] 407 dbj ADLYHNRGMAYYSMKAYDQAIEDFERSISLDPNS
2738092927380929|ref|NP_772458.1 | hypothetical protein bll5818 [Bradyrhizobium japonicum USDA 110]
27354095|dbj|BAC51083.1| bll5818 [Bradyrhizobium japonicum USDA 110]
407 ref AKAFNNRGVAYLRKGEYELAIEAFDDAIKLDPDY
2885625428856254|gb|AAH48062.1 | Small glutamine-rich tetratricopeptide repeat (TPR)-containing [Danio rerio] 407 gb SKAYGRMGLALASLNKYSEAVSYYKKALELDPDN
49822724982272|gb|AAD36762.1 | conserved hypothetical protein [Thermotoga maritima MSB8]
15644443|ref|NP_229495.1| hypothetical protein TM1695 [Thermotoga maritima MSB8]
407 gb VQAYASLGEAYYNLGDYEKAIHYWERELEYNPND
6214776462147764|emb|CAH63508.1 | conserved hypothetical protein [Chlamydophila abortus S26/3]
62184697|ref|YP_219482.1| hypothetical protein CAB050 [Chlamydophila abortus S26/3]
407 emb AECWFSLGGVYHRLGKYTEAIECFDKILELDPWN
7167544071675440|ref|ZP_00673185.1 | TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71671556|gb|EAO28221.1| TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
407 ref AEAWCNLGVILLKQGQIELAIEYFRKSLELNPDY
1354087513540875|ref|NP_110563.1 | TPR-repeat-containing protein [Thermoplasma volcanium GSS1] 407 ref ADLYHNRGMAYYSMKAYDQAIEDFERSISLDPNS
6700531967005319|gb|AAY62245.1 | TPR [Rickettsia felis URRWXCal2]
67459786|ref|YP_247410.1| TPR [Rickettsia felis URRWXCal2]
406 gb AEAYFNKGVLLEDLGEYETAIKLYNKALELNPNY
2821141828211418|ref|NP_782362.1 | conserved protein, tetratricopeptide repeat family protein [Clostridium tetani E88]
28203859|gb|AAO36299.1| conserved protein, tetratricopeptide repeat family protein [Clostridium tetani E88]
406 ref ERAYYGLAIIYEEEGEYEKALKNYKKAIELNPYY
8928423089284230|gb|EAR82286.1 | SLEI family protein [Tetrahymena thermophila SB210] 406 gb IVAYNNIGLVYYNLKNSDQALEYYKKALEIDPNY
6854664868546648|ref|ZP_00586194.1 | TPR repeat [Shewanella amazonensis SB2B]
68515726|gb|EAN39441.1| TPR repeat [Shewanella amazonensis SB2B]
406 ref APAWFRLGNIYTRTGRHDAAIAAYQRCIELEPDN
7239724172397241|gb|AAZ71514.1 | TPR repeat [Methanosarcina barkeri str. fusaro]
73670079|ref|YP_306094.1| TPR repeat [Methanosarcina barkeri str. fusaro]
404 gb PEAWNNKGVALSNLSNYEEAIKAYNKAIELDPQN
50525345052534|gb|AAD38597.1 | BcDNA.GH04245 [Drosophila melanogaster] 403 gb AEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDF
2458582924585829|ref|NP_724407.1 | O-glycosyltransferase CG10392-PC, isoform C [Drosophila melanogaster]
24585827|ref|NP_724406.1| O-glycosyltransferase CG10392-PA, isoform A [Drosophila melanogaster]
17647755|ref|NP_523620.1| O-glycosyltransferase CG10392-PB, isoform B [Drosophila melanogaster]
6942068|gb|AAF32311.1| O-glycosyltransferase [Drosophila melanogaster]
10728168|gb|AAG22339.1| CG10392-PC, isoform C [Drosophila melanogaster]
73022
403 ref AEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDF
26211062621106|gb|AAB84576.1 | O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
15678100|ref|NP_275215.1| O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
403 gb AEAWNNKGVVLKELKRYDEALECYERALQIDPQD
6792026267920262|ref|ZP_00513782.1 | TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
67857746|gb|EAM52985.1| TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
403 ref SFAYNNMGNALRKQGKLEEAIAAYKKAIELDPND
7239724172397241|gb|AAZ71514.1 | TPR repeat [Methanosarcina barkeri str. fusaro]
73670079|ref|YP_306094.1| TPR repeat [Methanosarcina barkeri str. fusaro]
403 gb LDAWTNKGKALSSLGDYEEAIKAYDKALEIEPQD
8860402688604026|ref|YP_504204.1 | TPR repeat [Methanospirillum hungatei JF-1]
88189488|gb|ABD42485.1| TPR repeat [Methanospirillum hungatei JF-1]
402 ref AYAWYNKGNALYHLKEYKEAIEAYKKALEIDPEY
5566343155663431|ref|XP_521123.1 | PREDICTED: O-linked GlcNAc transferase [Pan troglodytes] 402 ref AEAYSNLGNVYKERGQLQEAIEHYRHALRLIPDF
6837253468372534|ref|XP_697561.1 | PREDICTED: similar to O-GlcNAc transferase variant 1 [Danio rerio] 402 ref AEAYSNLGNVHKERGQLQEAIERYRQALRLKPDF
6836379468363794|ref|XP_694454.1 | PREDICTED: similar to O-GlcNAc transferase variant 3 [Danio rerio] 402 ref AEAYSNLGNVHKERGQLQEAIERYRQALRLKPDF
3998314839983148|gb|AAR34542.1 | TPR domain protein [Geobacter sulfurreducens PCA]
39996268|ref|NP_952219.1| TPR domain protein [Geobacter sulfurreducens PCA]
401 gb ADGYVNIGLVYNSLEETSKAIEAFEKALEIDPAN
7167544071675440|ref|ZP_00673185.1 | TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71671556|gb|EAO28221.1| TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
401 ref AEAWCNLGVVLRKQGQIELAIEYFRKSLELNPDY
9121671791216717|ref|ZP_01253682.1 | aerotolerance-related exported protein [Psychroflexus torquis ATCC 700755]
91185186|gb|EAS71564.1| aerotolerance-related exported protein [Psychroflexus torquis ATCC 700755]
401 ref TELYFNLGNAYFKQNDLANAIFHYEKALQLNPAD
7189477571894775|ref|NP_001026589.1 | small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Gallus gallus]
53133738|emb|CAG32198.1| hypothetical protein [Gallus gallus]
400 ref SKAYGRMGLALTSVNKYEEAITSYQKALDLDPEN
5185814751858147|dbj|BAD42305.1 | conserved hypothetical protein [Symbiobacterium thermophilum IAM 14863]
51894458|ref|YP_077149.1| hypothetical protein STH3324 [Symbiobacterium thermophilum IAM 14863]
400 dbj PQAYSNLGNLDYSRGAYEAALEKYKKAVELDPDN
8860210588602105|ref|YP_502283.1 | Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
88187567|gb|ABD40564.1| Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
399 ref AAAWNNMGVTYFNMKEYDKANSAFDKAISLKPDE
5722281257222812|gb|AAW40856.1 | cytoplasm protein, putative [Cryptococcus neoformans var. neoformans JEC21]
58258525|ref|XP_566675.1| cytoplasm protein [Cryptococcus neoformans var. neoformans JEC21]
50260964|gb|EAL23614.1| hypothetical protein CNBA2610 [Cryptococcus neoformans var. neoformans B-3501A]
399 gb TKAYSRLGHAHFSLGNYSDAVRAYENGLELDPDN
9120364091203640|emb|CAJ71293.1 | hypothetical protein [Candidatus Kuenenia stuttgartiensis] 399 emb PQSYYNLGFAYENLEEGERAVQAYRRAVQLDPDN
9120318591203185|emb|CAJ72824.1 | hypothetical protein [Candidatus Kuenenia stuttgartiensis] 399 emb PQAYFKIGTVYFDMEEYEPAIEYLKKTIEMNPDY
2633687726336877|dbj|BAC32122.1 | unnamed protein product [Mus musculus] 398 dbj ADLWYNLAIVYIELKEPNEALKNFNRALELNPKH
3244443832444438|emb|CAD74436.1 | conserved hypothetical protein-putative TPR-repeat-containing protein [Rhodopirellula baltica SH 1]
32473901|ref|NP_866895.1| conserved hypothetical protein-putative TPR-repeat-containing protein [Rhodopirellula baltica SH 1]
398 emb AHAYSSRGLFYAARGEHDAAIKDYERALKLDPED
7413899974138999|dbj|BAE38405.1 | unnamed protein product [Mus musculus]
75677476|ref|NP_001028504.1| hypothetical protein LOC237500 [Mus musculus]
398 dbj ADLWYNLAIVYIELKEPNEALKNFNRALELNPKH
4925785649257856|gb|AAH74276.1 | MGC84046 protein [Xenopus laevis] 397 gb SKAYGRMGRALVAMSRYKEAFESYQKALDLDPEN
7239823472398234|gb|AAZ72507.1 | TPR-domain containing protein [Methanosarcina barkeri str. fusaro]
73671072|ref|YP_307087.1| TPR-domain containing protein [Methanosarcina barkeri str. fusaro]
397 gb QDTCYQLGLSYFELGNFEEAIRVFESALKMDPEN
29841752984175|gb|AAC07708.1 | hypothetical protein aq_1896 [Aquifex aeolicus VF5]
15606922|ref|NP_214303.1| hypothetical protein aq_1896 [Aquifex aeolicus VF5]
396 gb PRIWNALGLAYMEAKEYKKAEESFKKALSINPNY
7167806971678069|ref|ZP_00675799.1 | TPR repeat [Trichodesmium erythraeum IMS101]
71668763|gb|EAO25443.1| TPR repeat [Trichodesmium erythraeum IMS101]
396 ref AGVYTKLGKAQLKQGQLDEAIATYQKAIELDPSS
7821978478219784|gb|ABB39133.1 | TPR repeat [Desulfovibrio desulfuricans G20]
78357379|ref|YP_388828.1| TPR repeat [Desulfovibrio desulfuricans G20]
396 gb PDVWNNRGMMYLAQGDAQKAMADFDKALRLDPEH
9120261391202613|emb|CAJ72252.1 | Hypothetical Protein [Candidatus Kuenenia stuttgartiensis] 396 emb AEAHSNLGFIYTETNRFEEALSELKKALRLNPDH
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 396 gb AVAYNNVGVVYNKQGLYDAALEYYKKALDVDPHY
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 396 gb AVAYNNVGVVYNKQGLYDAALEYYKKALDVDPHY
8928423089284230|gb|EAR82286.1 | SLEI family protein [Tetrahymena thermophila SB210] 396 gb VQAYERLGFVFQNRKKYEEAIKNYKKAIELDPKY
6700531967005319|gb|AAY62245.1 | TPR [Rickettsia felis URRWXCal2]
67459786|ref|YP_247410.1| TPR [Rickettsia felis URRWXCal2]
395 gb YDAYFNKGLALEELGKYDLALESYNKALELEPDN
3363566233635662|emb|CAE21986.1 | TPR repeat:HAT (Half-A-TPR) repeat [Prochlorococcus marinus str. MIT 9313]
33864078|ref|NP_895638.1| TPR repeat:HAT (Half-A-TPR) repeat [Prochlorococcus marinus str. MIT 9313]
395 emb ADAYLNLGNILKEEGDVEEAIASYRKAIELKPDF
3363566133635661|emb|CAE21985.1 | TPR repeat [Prochlorococcus marinus str. MIT 9313]
33864077|ref|NP_895637.1| TPR repeat [Prochlorococcus marinus str. MIT 9313]
395 emb ADAYLNLGNILKEEGDVEEAIASYRKAIELKPDF
29835682983568|gb|AAC07141.1 | hypothetical protein aq_1088 [Aquifex aeolicus VF5]
12230801|sp|O67178|Y1088_AQUAE Hypothetical protein aq_1088
15606362|ref|NP_213741.1| hypothetical protein aq_1088 [Aquifex aeolicus VF5]
395 gb VEILYNLGVLHLNKGELEKALDLFERALRLKPDF
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 395 gb LSAHLYLGISYKKQGNLEEALQCYKKAIQLNPNS
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 395 gb SEAYDKLGLVYEENEQFEEAIECYKKAIEHKPNS
2122921221229212|ref|NP_635134.1 | hypothetical protein MM3110 [Methanosarcina mazei Go1]
20907782|gb|AAM32806.1| hypothetical protein MM_3110 [Methanosarcina mazei Go1]
394 ref PDTLFKIGKIHLRLGEQEKAIQAFKKALEIKPEN
28425832842583|sp|Q58350 |Y940_METJA Hypothetical protein MJ0940
1591608|gb|AAB98944.1| transformation sensitive protein [Methanocaldococcus jannaschii DSM 2661]
15669130|ref|NP_247935.1| transformation sensitive protein [Methanocaldococcus jannaschii DSM 2661]
394 ASLWYFKGKLYEKQNKFEEALKYYNKAIQLMPHH
7167516171675161|ref|ZP_00672907.1 | Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
71672137|gb|EAO28801.1| Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
394 ref ADAYKNRGNVYYNQGKYDLALADYNQAIQLNPKY
4721150547211505|emb|CAF94124.1 | unnamed protein product [Tetraodon nigroviridis] 394 emb ADILTPLGALYYNTGRYEEALQVYREATSLQPDN
8660966286609662|ref|YP_478424.1 | photosystem I assembly protein Ycf3 [Synechococcus sp. JA-2-3B'a(2-13)]
86558204|gb|ABD03161.1| photosystem I assembly protein Ycf3 [Synechococcus sp. JA-2-3B'a(2-13)]
394 ref SYILYNMGLIYQSNGELDKALEYYHQALELNPRL
8660601886606018|ref|YP_474781.1 | photosystem I assembly protein Ycf3 [Synechococcus sp. JA-3-3Ab]
86554560|gb|ABC99518.1| photosystem I assembly protein Ycf3 [Synechococcus sp. JA-3-3Ab]
394 ref SYILYNMGLIYQSNGELDKALEYYHQALELNPRL
8929188389291883|gb|EAR89871.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 394 gb FNTQFNLGLLYYQEQKYDEALTYFQKVIEINPKS
8929021189290211|gb|EAR88199.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 394 gb AEAYNNLGCIYYEKGNLKEAINQFEEAIKANPKF
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 394 gb VNSYIQLGNIYSDKASYEQATEYYQKILEIEPNN
6792026267920262|ref|ZP_00513782.1 | TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
67857746|gb|EAM52985.1| TPR repeat:Sel1-like repeat:Sel1-like repeat [Crocosphaera watsonii WH 8501]
393 ref SFAYNNMGVALRKQGKYDEAIAAYKKAIEINPNY
4722245047222450|emb|CAG12970.1 | unnamed protein product [Tetraodon nigroviridis] 393 emb IDAYKSLGQAYRELGDFESAMESFQRALLLDQNH
9120210191202101|emb|CAJ75161.1 | hypothetical protein [Candidatus Kuenenia stuttgartiensis] 393 emb PEAHFNLGVAYDESGMYGEAIEAFKQAIRINPDH
8930586189305861|gb|EAS03849.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 393 gb SNAYLNKGSLFLFSGKYEEAIKNYDKVIQLDPNH
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 393 gb INAYIELGNLYLGKAEYDQALECYQKIIQINPQK
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 393 gb SVAYNNIGLIYLRQNMLDEALEQFNKAIEIDPKY
6793894367938943|ref|ZP_00531459.1 | TPR repeat:TPR repeat [Chlorobium phaeobacteroides BS1]
67914827|gb|EAM64159.1| TPR repeat:TPR repeat [Chlorobium phaeobacteroides BS1]
393 ref VDAYCLLGDVYIDIGKYDKAREMIEKALELDPDG
3026869530268695|gb|AAP29458.1 | small glutamine rich protein with tetratricopeptide repeats 2 [Rattus norvegicus]
31745160|ref|NP_853660.1| small glutamine rich protein with tetratricopeptide repeats 2 [Rattus norvegicus]
392 gb SKAYGRMGLALTAMNKFEEAVTSYQKALDLDPEN
2145023121450231|ref|NP_659087.1 | small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Mus musculus]
17160880|gb|AAH17611.1| Small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Mus musculus]
26340544|dbj|BAC33934.1| unnamed protein product [Mus musculus]
26349533|dbj|BAC38406.1| unnamed protein product [Mus musculus]
52783415|sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protei
392 ref SKAYGRMGLALTAMNKFEEAVTSYQKALDLDPEN
1971301619713016|gb|AAL93886.1 | Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
19705092|ref|NP_602587.1| Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
392 gb ACYFNNRGHSYFALNKYSEAIEDYDKAIKLDPNN
8930850689308506|gb|EAS06494.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 392 gb INAYNNLGLIYEMKGKLDDALTCYQKALEINPNY
7836591078365910|ref|ZP_00836194.1 | TPR repeat [Shewanella sp. PV-4]
78362133|gb|EAP03953.1| TPR repeat [Shewanella sp. PV-4]
392 ref APAWFRLGNIYTRTNRHEAAIAAYRRCIELEPNN
8860364988603649|ref|YP_503827.1 | Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
88189111|gb|ABD42108.1| Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
391 ref TAAWLLLGNSYKVLNQFDEAIDAYEEAMELDPGS
8860287888602878|ref|YP_503056.1 | Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
88188340|gb|ABD41337.1| Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
391 ref ENSWLLIGFAYNRLEQYEEALQRFDKAIEIDPKR
7239724172397241|gb|AAZ71514.1 | TPR repeat [Methanosarcina barkeri str. fusaro]
73670079|ref|YP_306094.1| TPR repeat [Methanosarcina barkeri str. fusaro]
391 gb SVAWNGLGFAVASSGNYEEAIKFYNKAIEIDPQN
8930850689308506|gb|EAS06494.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 391 gb VNAYNNIGLVYYDKKMFDEALESYNKAIEINPKY
8929188389291883|gb|EAR89871.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 391 gb VEAYEILGFIYQNISKKEEAIKYYKKAIEIDPNH
8893502288935022|ref|ZP_01140660.1 | TPR repeat [Geobacter uraniumreducens Rf4]
88918287|gb|EAR37468.1| TPR repeat [Geobacter uraniumreducens Rf4]
391 ref LQAWIQLGNDYFDTDQSKKAVDAYSKALELDPNN
8385769883857698|ref|ZP_00951226.1 | beta-lactamase, putative [Croceibacter atlanticus HTCC2559]
83849065|gb|EAP86934.1| beta-lactamase, putative [Croceibacter atlanticus HTCC2559]
391 ref SNPFDSLGEAYLEEGNYQMALKNYKKALSLDPNA
3476271734762717|ref|ZP_00143707.1 | TETRATRICOPEPTIDE REPEAT FAMILY PROTEIN [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
27887616|gb|EAA24695.1| TETRATRICOPEPTIDE REPEAT FAMILY PROTEIN [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
390 ref TSYYYNRGKVFYNLKKYKKAITDFNKAIKLNPND
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 390 gb VEAYERLGYVYQNTSKKEEAIKHYKKAIEIDPKY
8928423089284230|gb|EAR82286.1 | SLEI family protein [Tetrahymena thermophila SB210] 390 gb VDAYNNLGLVYFGLDMNNEAIQYYQKALELNPDY
1508228315082283|gb|AAH12044.1 | Small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Homo sapiens]
24308141|ref|NP_061945.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Homo sapiens]
21755789|dbj|BAC04761.1| unnamed protein product [Homo sapiens]
30268697|gb|AAP29459.1| small glutamine rich protein with tetratricopeptide repeats 2 [Homo sapiens]
41018109|sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetrat
389 gb SKAYGRMGLALTALNKFEEAVTSYQKALDLDPEN
4252594442525944|ref|NP_971042.1 | TPR domain protein [Treponema denticola ATCC 35405]
41815994|gb|AAS10923.1| TPR domain protein [Treponema denticola ATCC 35405]
389 ref ADSYLTRGKAYLALKEYKKAIEDFDRAIELDSDN
26211062621106|gb|AAB84576.1 | O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
15678100|ref|NP_275215.1| O-linked GlcNAc transferase [Methanothermobacter thermautotrophicus str. Delta H]
389 gb DETWANKGVLLRKLGKYEEALECFEKALEINPEF
5562425455624254|ref|XP_526906.1 | PREDICTED: similar to small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta; small glutamine rich protein with tetratricopeptide repeats 2 [Pan troglodytes] 389 ref SKAYGRMGLALTALNKFEEAVTSYQKALDLDPEN
8930850689308506|gb|EAS06494.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 389 gb VNAYNNIGLIFYNQRKLDDALEYYDKALQINPNY
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 389 gb FEAYDRLGLVHEENNRFEEAIENYKKAIEINPQS
3767603537676035|ref|NP_936431.1 | TPR repeat containing protein [Vibrio vulnificus YJ016]
37200575|dbj|BAC96401.1| TPR repeat containing protein [Vibrio vulnificus YJ016]
388 ref AESLYNLGNALAQNGQYDKALEAYQKALAKNPNL
5524168855241688|gb|EAA07878.2 | ENSANGP00000018230 [Anopheles gambiae str. PEST]
58382258|ref|XP_311818.2| ENSANGP00000018230 [Anopheles gambiae str. PEST]
388 gb SKAWGRLGLAYSKMNEHKQAVTAYQNAIRLEPDN
2736790827367908|ref|NP_763435.1 | TPR repeat containing protein [Vibrio vulnificus CMCP6]
27359481|gb|AAO08425.1| TPR repeat containing protein [Vibrio vulnificus CMCP6]
388 ref AESLYNLGNALAQNGQYDKALEAYQKALAKNPNL
1971301619713016|gb|AAL93886.1 | Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
19705092|ref|NP_602587.1| Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
388 gb ASYFNNRGVAYNNLGEYSKALEDYDKAIKLNPNY
7167592871675928|ref|ZP_00673671.1 | Protein kinase:TPR repeat:Serine/threonine protein kinase [Trichodesmium erythraeum IMS101]
71670789|gb|EAO27456.1| Protein kinase:TPR repeat:Serine/threonine protein kinase [Trichodesmium erythraeum IMS101]
388 ref TQAYKKRGLIYYEIGDYKSAIQDYSESIRLNPKD
5072898450728984|ref|XP_416374.1 | PREDICTED: similar to ARG99 protein [Gallus gallus] 388 ref AEILSPLGALYYNTGRYEEALQVYREAASLQPSN
8930473189304731|gb|EAS02719.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 388 gb SAAMYNLANTYYVLEDHEKASDYFEKAIQLEPNN
8928423089284230|gb|EAR82286.1 | SLEI family protein [Tetrahymena thermophila SB210] 388 gb IDSHIELGCIYLDKKEYQQAIEYFNKVIELDPKE
8871178388711783|ref|ZP_01105871.1 | aerotolerance-related exported protein [Flavobacteriales bacterium HTCC2170]
88710724|gb|EAR02956.1| aerotolerance-related exported protein [Flavobacteriales bacterium HTCC2170]
388 ref HKAYHNMGNVFMKQKQYEKAVEAYKEALRNNPKD
6791834567918345|ref|ZP_00511944.1 | TPR repeat [Chlorobium limicola DSM 245]
67784001|gb|EAM43381.1| TPR repeat [Chlorobium limicola DSM 245]
388 ref ADAWFRLGNAFARNEQYRKASEAYREALSIDPEK
4006304740063047|gb|AAR37903.1 | TPR domain/sulfotransferase domain protein [uncultured bacterium 560] 387 gb SNAYYNLGNVLRELGQLDDAVKSYEKAIAIKPDY
2421550324215503|ref|NP_712984.1 | TPR-repeat-containing proteins [Leptospira interrogans serovar Lai str. 56601]
24196638|gb|AAN50002.1| TPR-repeat-containing proteins [Leptospira interrogans serovar Lai str. 56601]
387 ref ASAYYNRGLVHYTLKRYNDAVRDFEKAVEIDPSK
4565710545657105|ref|YP_001191.1 | hypothetical protein LIC11222 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
45600342|gb|AAS69828.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
387 ref ASAYYNRGLVHYTLKRYNDAVRDFEKAVEIDPSK
7167544071675440|ref|ZP_00673185.1 | TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71671556|gb|EAO28221.1| TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
387 ref TKAYSNLAKLMKKEGRLEEAIAHYQKAIELEPNN
7167696471676964|ref|ZP_00674703.1 | TPR repeat [Trichodesmium erythraeum IMS101]
71669675|gb|EAO26346.1| TPR repeat [Trichodesmium erythraeum IMS101]
387 ref SQAYINLGTMFYRQGKLEEAIANYYKAIQLQPEM
8989876289898762|ref|YP_515872.1 | hypothetical protein CF0955 [Chlamydophila felis Fe/C-56]
89332134|dbj|BAE81727.1| conserved hypothetical protein [Chlamydophila felis Fe/C-56]
387 ref AECWFSLGGVYHRLGQYIEAIECFDKILELDPWN
6652049166520491|ref|XP_623820.1 | PREDICTED: similar to ENSANGP00000020579 [Apis mellifera] 387 ref AEAYSNLGNVFKERGQLQEALENYRHAVRLKPDF
8930850689308506|gb|EAS06494.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 387 gb AEAYERLGWVYENQNLIDQAIDSYKKAIEIDPNH
8930412989304129|gb|EAS02117.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 387 gb NDVYYNLGLVYQQKGQLDESIKWYKKCLNLNPND
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 387 gb AAIFNGIGFMYYTQKSYDQAIENFNKALEINPNY
6854833968548339|ref|ZP_00587848.1 | TPR repeat [Shewanella amazonensis SB2B]
68513974|gb|EAN37726.1| TPR repeat [Shewanella amazonensis SB2B]
387 ref ADAYNFLGIYYTQEGDFDNAYEAFDAVLELEPNY
8615978386159783|ref|YP_466568.1 | tetratricopeptide repeata protein [Anaeromyxobacter dehalogenans 2CP-C]
85776294|gb|ABC83131.1| tetratricopeptide repeata protein [Anaeromyxobacter dehalogenans 2CP-C]
386 ref ADVYNMLGVIYHDQGQYQKALRAFEAALRINPGY
7167516171675161|ref|ZP_00672907.1 | Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
71672137|gb|EAO28801.1| Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
386 ref AEAYNNRGGVYLEQGKYDLAIADYNQAIQLNPKL
7167512771675127|ref|ZP_00672873.1 | UvrD/REP helicase:TPR repeat [Trichodesmium erythraeum IMS101]
71672103|gb|EAO28767.1| UvrD/REP helicase:TPR repeat [Trichodesmium erythraeum IMS101]
386 ref LQTYNNLGAAYVELGEFNEAIELFSQALKVDSQD
7239724172397241|gb|AAZ71514.1 | TPR repeat [Methanosarcina barkeri str. fusaro]
73670079|ref|YP_306094.1| TPR repeat [Methanosarcina barkeri str. fusaro]
386 gb AVAWYDKGSILKNLGNYEEAVEAFDKATELDPKK
7201404172014041|ref|XP_784504.1 | PREDICTED: similar to O-linked N-acetylglucosamine transferase [Strongylocentrotus purpuratus] 386 ref AEAYSNLGNVFKEKGQLQEALENYRHAVRLKPDF
8660696186606961|ref|YP_475724.1 | protein kinase domain/TPR repeat protein [Synechococcus sp. JA-3-3Ab]
86555503|gb|ABD00461.1| protein kinase domain/TPR repeat protein [Synechococcus sp. JA-3-3Ab]
386 ref ALAYYSRGNAYRQLDQPQQAIEDYSRALELNPEE
8928449889284498|gb|EAR82541.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 386 gb ATSYNGRGLVHDKLGDYEKAMQDFTQAIQLEPTN
9059072690590726|ref|ZP_01246372.1 | TPR repeat [Flavobacterium johnsoniae UW101]
90433231|gb|EAS58594.1| TPR repeat [Flavobacterium johnsoniae UW101]
386 ref HKAYHNLGNVFMKEKDYSQAVEAYKEALRNDPTD
7239823472398234|gb|AAZ72507.1 | TPR-domain containing protein [Methanosarcina barkeri str. fusaro]
73671072|ref|YP_307087.1| TPR-domain containing protein [Methanosarcina barkeri str. fusaro]
385 gb GSAWYARGTVTGKTGNYEEALECFEHALEINPKN
1971301619713016|gb|AAL93886.1 | Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
19705092|ref|NP_602587.1| Tetratricopeptide repeat family protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
385 gb AFYYDNRGLAYEKLKKYKEAINDYNKAIKLNPNN
7167516171675161|ref|ZP_00672907.1 | Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
71672137|gb|EAO28801.1| Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
385 ref AEAYNNRGLVYDDQGKYDLAIAEFNQAIQLNPKY
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 385 gb VEAYERLGFVYQNEKNNSEAIKYYKKAIEIDPNY
6793833467938334|ref|ZP_00530861.1 | TPR repeat:TPR repeat [Chlorobium phaeobacteroides BS1]
67915442|gb|EAM64763.1| TPR repeat:TPR repeat [Chlorobium phaeobacteroides BS1]
385 ref PQAYIRLGNEYAKQQLYDKAVEAYENALSLNPQS
3334882033348820|gb|AAQ16110.1 | small glutamine-rich tetratricopeptide [Schistosoma japonicum] 384 gb SKAYGRMGIAYSSIGNHAKAVECYRKGLELDPNN
8860442288604422|ref|YP_504600.1 | TPR repeat [Methanospirillum hungatei JF-1]
88189884|gb|ABD42881.1| TPR repeat [Methanospirillum hungatei JF-1]
384 ref ASAWYELANAYYQTGQYDQALEAINSALTIDPYT
7102255371022553|ref|XP_761506.1 | hypothetical protein UM05359.1 [Ustilago maydis 521]
46101375|gb|EAK86608.1| hypothetical protein UM05359.1 [Ustilago maydis 521]
384 ref GKAYSRLGHALFSSGRYQEAVEAYQKGVEVDPSN
7167593671675936|ref|ZP_00673679.1 | Sulfotransferase:TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71670797|gb|EAO27464.1| Sulfotransferase:TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
384 ref VDAYQNLGDISLKTKDFNEAINYYQKAIELKPDL
7239724172397241|gb|AAZ71514.1 | TPR repeat [Methanosarcina barkeri str. fusaro]
73670079|ref|YP_306094.1| TPR repeat [Methanosarcina barkeri str. fusaro]
384 gb TETWNNRGSAFFLIGNYEEAMKNYNKTIELDPEY
5704286957042869|ref|XP_535258.1 | PREDICTED: similar to small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Canis familiaris] 384 ref SKAYGRMGLALTAINKFEEAVTSYQKALDLDPEN
1991311719913117|emb|CAC85169.1 | SPY protein [Lycopersicon esculentum]
19913115|emb|CAC85168.1| SPY protein [Lycopersicon esculentum]
75330646|sp|Q8RVB2|SPY_LYCES Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (LeSPY)
384 emb AEAYNNLGVLYRDAGNISLAIEAYEQCLKIDPDS
9120292691202926|emb|CAJ72565.1 | hypothetical protein [Candidatus Kuenenia stuttgartiensis] 384 emb AEAHNNLGITYRKKGMHEEAYNEYQKALQLNPDY
5368879953688799|ref|ZP_00111451.2 | COG0457: FOG: TPR repeat [Nostoc punctiforme PCC 73102] 384 ref AKIHSGIGYLYAQQGNYQAALTSYRRAIAINPNN
7531881875318818|sp|O82039 |SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY (PhSPY)
3319682|emb|CAA76834.1| SPINDLY protein [Petunia x hybrida]
384 AEAYNNLGVLYRDAGNISLAIEAYEQCLKIDPDS
8929359989293599|gb|EAR91587.1 | DNA polymerase family B containing protein [Tetrahymena thermophila SB210] 384 gb AQALNNLGSIYYKNGKIEDAIEYYKKAQQVDPQF
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 384 gb EIAYNNIGLIYYDQGKNDQALEQYNKALEINPKY
7167807471678074|ref|ZP_00675804.1 | Glycosyl transferase, group 1:TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71668768|gb|EAO25448.1| Glycosyl transferase, group 1:TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
384 ref PELYFGLGNVWLEKKEFDQAITSYEKAIDINPNL
7819449478194494|gb|ABB32261.1 | TPR repeat protein [Geobacter metallireducens GS-15]
78223239|ref|YP_384986.1| TPR repeat protein [Geobacter metallireducens GS-15]
383 gb PGAYYYLGLSYYQRNDLESALSQFRKVIDLNPKH
3386674133866741|ref|NP_898300.1 | Possible glycosyltransferase 2 fused to TPR-repeat domain [Synechococcus sp. WH 8102]
33639342|emb|CAE08724.1| Possible glycosyltransferase 2 fused to TPR-repeat domain [Synechococcus sp. WH 8102]
383 ref ALGWYNLGLMLRRRGDIAAALEAYSRAVELDPNN
2122628021226280|ref|NP_632202.1 | hypothetical protein MM0178 [Methanosarcina mazei Go1]
20904523|gb|AAM29874.1| conserved protein [Methanosarcina mazei Go1]
383 ref AAAWCAMGTVAGKAERYEEALENFERALEINPKD
4252704442527044|ref|NP_972142.1 | TPR domain protein [Treponema denticola ATCC 35405]
41817468|gb|AAS12053.1| TPR domain protein [Treponema denticola ATCC 35405]
383 ref ADAWDSLGLVLFETGDIDQAERAFESAIKLEPEN
6792547367925473|ref|ZP_00518813.1 | TPR repeat:TPR repeat [Crocosphaera watsonii WH 8501]
67852680|gb|EAM48099.1| TPR repeat:TPR repeat [Crocosphaera watsonii WH 8501]
383 ref DRAYNNRGNCYAHQGNLSKAIENYEKALDINPYN
7167544071675440|ref|ZP_00673185.1 | TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71671556|gb|EAO28221.1| TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
383 ref TEAYSNLAKLMKKEGRLEEAIAHYQKAISLEPNN
6183418161834181|ref|XP_613486.1 | PREDICTED: similar to small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Bos taurus] 383 ref SKAYGRMGLALTAMNKFQEAVTSYQKALDLDPEN
9107987591079875|ref|XP_967579.1 | PREDICTED: similar to CG10392-PB, isoform B [Tribolium castaneum] 383 ref AEAYSNLGNVYKERSQLQEALDNYRHAVRLKPDF
6654673366546733|ref|XP_393400.2 | PREDICTED: similar to Small glutamine-rich tetratricopeptide repeat (TPR)-containing [Apis mellifera] 383 ref SKAYGRLGLAYSSLQRHKEAKESYQKALEMEPDN
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 383 gb VDAYNNIGLIYYYKGMIKEALESYKKALEIDPKY
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 383 gb TEAYYELGRTYEEQNMLDDAIVNYKKAIQLDPSH
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 383 gb TEAYYELGRTYEEQNMLDDAIVNYKKAIQLDPSH
7819486178194861|gb|ABB32628.1 | Tetratricopeptide TPR_4 [Geobacter metallireducens GS-15]
78223606|ref|YP_385353.1| Tetratricopeptide TPR_4 [Geobacter metallireducens GS-15]
382 gb SDAHVNIGLVYNSLERTQKAIKAFEKALEIDPAN
1713066917130669|dbj|BAB73279.1 | all1322 [Nostoc sp. PCC 7120]
17228817|ref|NP_485365.1| hypothetical protein all1322 [Nostoc sp. PCC 7120]
382 dbj AVVWLNRGLALIELEEYEEAIASFDQALELQPNS
7167544071675440|ref|ZP_00673185.1 | TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71671556|gb|EAO28221.1| TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
382 ref AQAYNNLGFVFQEKGNLSKASNYYQQALEINPNY
7816651878166518|gb|ABB23616.1 | TPR repeat [Pelodictyon luteolum DSM 273]
78186616|ref|YP_374659.1| TPR repeat [Pelodictyon luteolum DSM 273]
382 gb AETWCVLGDVHLDLGEYDEARVAFDHALELEPDN
7796556177965561|gb|ABB06941.1 | TPR repeat protein [Burkholderia sp. 383]
78064816|ref|YP_367585.1| TPR repeat protein [Burkholderia sp. 383]
382 gb AEAYNNLGNALQDLGDFDRAASHYGRAIELDPSM
8661013586610135|ref|YP_478897.1 | tetratricopeptide repeat protein [Synechococcus sp. JA-2-3B'a(2-13)]
86558677|gb|ABD03634.1| tetratricopeptide repeat protein [Synechococcus sp. JA-2-3B'a(2-13)]
382 ref ARAYYGLGLVLASQEQYSEAVKNYRRALELAPDL
9120397591203975|emb|CAJ71628.1 | similar to O-linked GlcNAc transferase [Candidatus Kuenenia stuttgartiensis] 382 emb TDAYVKLGFIYLARNDYGEALHYLQKAASLEPDN
7570290975702909|gb|ABA22585.1 | TPR repeat [Anabaena variabilis ATCC 29413]
75909184|ref|YP_323480.1| TPR repeat [Anabaena variabilis ATCC 29413]
381 gb TVAWSNRGLALIELEEYEEAIASFDKALELQPNS
6752788967527889|ref|XP_661796.1 | hypothetical protein AN4192.2 [Aspergillus nidulans FGSC A4]
40740101|gb|EAA59291.1| hypothetical protein AN4192.2 [Aspergillus nidulans FGSC A4]
381 ref ADSFKLAGNKFFKDGNYNRAIEEFTKAIELNPNN
4645040346450403|gb|AAS97051.1 | TPR domain protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough]
46580983|ref|YP_011791.1| TPR domain protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough]
381 gb ADAWTHLGHLYFDTHQAKEAIRAYERSLALKPND
6682716966827169|ref|XP_646939.1 | hypothetical protein DDB0190016 [Dictyostelium discoideum]
60475035|gb|EAL72971.1| hypothetical protein DDBDRAFT_0190016 [Dictyostelium discoideum AX4]
381 ref ANRYYELGVYYLKQHDYEKALTHFDKSYEINPTS
2983416429834164|gb|AAP04801.1 | type III secretion chaperone, putative [Chlamydophila caviae GPIC]
29839817|ref|NP_828923.1| type III secretion chaperone, putative [Chlamydophila caviae GPIC]
381 gb AECWFSLGGVYHRLGRYIEAIECFDRILELDPWN
1753544717535447|ref|NP_494893.1 | Small Glutamine-rich Tetratrico repeat protein family member (sgt-1) [Caenorhabditis elegans]
1109816|gb|AAA83170.1| Hypothetical protein R05F9.10 [Caenorhabditis elegans]
381 ref SKAWGRMGLAYSCQNRYEHAAEAYKKALELEPNQ
7167482271674822|ref|ZP_00672568.1 | Glycosyl transferase, family 2:TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
71671798|gb|EAO28462.1| Glycosyl transferase, family 2:TPR repeat:Sel1-like repeat [Trichodesmium erythraeum IMS101]
381 ref PEIYANLGSLYAMQQKWEEAISYYQKAVDIKPDF
6819219268192192|gb|EAN06846.1 | TPR repeat [Mesorhizobium sp. BNC1]
69276286|ref|ZP_00611880.1| TPR repeat [Mesorhizobium sp. BNC1]
381 gb PEAYNIRGAAYGRGGNYREALKDFDRAIQLDPRS
3959677039596770|emb|CAE58997.1 | Hypothetical protein CBG02270 [Caenorhabditis briggsae] 381 emb SKAWGRMGLAYSCQNRYEHAAEAYKKALELEPNQ
7661927776619277|ref|XP_612516.2 | PREDICTED: similar to ARG99 protein isoform 2 [Bos taurus] 381 ref TEILSPLGALYYNTGRYEEALQTYREAVALQPSQ
8585872485858724|ref|YP_460926.1 | tetratricopeptide repeat family protein [Syntrophus aciditrophicus SB]
85721815|gb|ABC76758.1| tetratricopeptide repeat family protein [Syntrophus aciditrophicus SB]
381 ref VDVHLILGNLYINMKDYKNAIRSYRKVIEIDPKN
6836990868369908|ref|XP_696659.1 | PREDICTED: similar to tetratricopeptide repeat domain 13 [Danio rerio] 381 ref IDAYKSLGQAYRELGDIENAMESFQKALLLDQNH
8930448089304480|gb|EAS02468.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 381 gb VDIYNNIGNVYFQLKDLEEAEHYFLKALQQDPND
8928423089284230|gb|EAR82286.1 | SLEI family protein [Tetrahymena thermophila SB210] 381 gb VQAYYYLAIIYQNTNRVDEAIDYYQKVIQLDPQH
8885760588857605|ref|ZP_01132248.1 | hypothetical protein PTD2_03556 [Pseudoalteromonas tunicata D2]
88820802|gb|EAR30614.1| hypothetical protein PTD2_03556 [Pseudoalteromonas tunicata D2]
381 ref ANAYDSLGETYASLGKIGEAIKNYQKVLELLPNN
8860442288604422|ref|YP_504600.1 | TPR repeat [Methanospirillum hungatei JF-1]
88189884|gb|ABD42881.1| TPR repeat [Methanospirillum hungatei JF-1]
380 ref APAWYFTGTTYTELGNYAQAIDALQSALTLDPSN
3364068233640682|emb|CAE20471.1 | TPR repeat [Prochlorococcus marinus str. MIT 9313]
33862569|ref|NP_894129.1| TPR repeat [Prochlorococcus marinus str. MIT 9313]
380 emb SNAYYNRGNAKSELKDYQEAIADYTKAIEIDPKD
2122943221229432|ref|NP_635354.1 | O-linked N-acetylglucosamine transferase [Methanosarcina mazei Go1]
20908028|gb|AAM33026.1| O-linked N-acetylglucosamine transferase [Methanosarcina mazei Go1]
380 ref ADILRNKGSALYMLGRYEEAIEAFNKSLELNPRD
5617908156179081|gb|AAV81803.1 | NlpI-like lipoprotein [Idiomarina loihiensis L2TR]
56460071|ref|YP_155352.1| NlpI-like lipoprotein [Idiomarina loihiensis L2TR]
380 gb ADAYNFLGIQYTQLEEFDYAYEAFDSAIELNPEH
7167516171675161|ref|ZP_00672907.1 | Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
71672137|gb|EAO28801.1| Peptidase S1, chymotrypsin:TPR repeat [Trichodesmium erythraeum IMS101]
380 ref AYAYYNRGNVYDDQGKYDLAIADYSQAIQLNPKY
6830498368304983|gb|AAY89994.1 | predicted O-linked GlcNAc transferase [uncultured bacterium BAC13K9BAC] 380 gb FQSFYSLGVAYTYLKNYEKAIEYYKKALSLDEES
5373244553732445|ref|ZP_00154299.2 | COG0457: FOG: TPR repeat [Rickettsia rickettsii] 380 ref FQAYLNKGAVLIQLGKYDLALEAYNKAIEVDPSH
8895170388951703|ref|ZP_01154180.1 | TPR repeat [Methanosaeta thermophila PT]
88929380|gb|EAR48330.1| TPR repeat [Methanosaeta thermophila PT]
380 ref VDAWNNRGIALSYMGRYEDALKSYDEALRLDPNH
5675837856758378|gb|AAW27329.1 | SJCHGC04001 protein [Schistosoma japonicum] 379 gb AEAYSNLGNVFKERGQLKEAIDNYRHALRIKPDF
8860220488602204|ref|YP_502382.1 | TPR repeat [Methanospirillum hungatei JF-1]
88187666|gb|ABD40663.1| TPR repeat [Methanospirillum hungatei JF-1]
379 ref SDAWNNLGWAYAEDKRYDEAVEALSKATSLDPEN
2122845021228450|ref|NP_634372.1 | O-linked N-acetylglucosamine transferase [Methanosarcina mazei Go1]
20906930|gb|AAM32044.1| O-linked N-acetylglucosamine transferase [Methanosarcina mazei Go1]
379 ref LEAYSSLGFVLAQLKRFEEALDIYEKALKLDPEA
7796635877966358|gb|ABB07738.1 | TPR repeat protein [Burkholderia sp. 383]
78065613|ref|YP_368382.1| TPR repeat protein [Burkholderia sp. 383]
379 gb PLAHYNLGNAYAALQRHDDAIDAFSRALRLTPDD
9497175394971753|ref|YP_593801.1 | TPR repeat protein [Acidobacteria bacterium Ellin345]
94553803|gb|ABF43727.1| TPR repeat protein [Acidobacteria bacterium Ellin345]
379 ref AEAHNNLGNLRLAQGDLEQAIASYQRALDLKPDY
7615535976155359|gb|AAX26638.2 | SJCHGC02946 protein [Schistosoma japonicum] 379 gb AEAYSNLGNVFKERGQLKEAIDNYRHALRIKPDF
9120331191203311|emb|CAJ72950.1 | conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] 379 emb VAAYEKLGKAYYTQGEFDKAGRIYRKAIEFDPYN
8930304189303041|gb|EAS01029.1 | SLEI family protein [Tetrahymena thermophila SB210] 379 gb IKAYIQLGNAYLDKPQYDLALESYQKIIEIDPKK
8929466689294666|gb|EAR92654.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 379 gb NNAIYNLGVTYYDLGQYEESLKYYSQAYDLNPDF
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 379 gb VEAYERLGYIYQNISKKEESIKYFKKAIEIDPNY
9122264791222647|ref|ZP_01258022.1 | TPR repeat [Psychroflexus torquis ATCC 700755]
91179546|gb|EAS67171.1| TPR repeat [Psychroflexus torquis ATCC 700755]
379 ref AEAYNNMGSALKNKGKIEEAIEAYTKALSIKPDY
8895072188950721|ref|ZP_01153295.1 | TPR repeat [Methanosaeta thermophila PT]
88929920|gb|EAR48868.1| TPR repeat [Methanosaeta thermophila PT]
379 ref AESWRQKGLALLSMGRYEEAIEAYRMALDIDPSQ
7570441475704414|gb|ABA24090.1 | TPR repeat [Anabaena variabilis ATCC 29413]
75910689|ref|YP_324985.1| TPR repeat [Anabaena variabilis ATCC 29413]
378 gb AEAYQNRGNAYYALGAYQKAIADYNRTLEINPHQ
7167416171674161|ref|ZP_00671908.1 | TPR repeat:RNA-processing protein, HAT helix [Trichodesmium erythraeum IMS101]
71672216|gb|EAO28879.1| TPR repeat:RNA-processing protein, HAT helix [Trichodesmium erythraeum IMS101]
378 ref AWNYYYLGQLFFQQGKWQDAVTQYRKAIKLNPNS
7791935377919353|ref|YP_357168.1 | Flp pilus assembly protein TadD contains TPR repeats-like [Pelobacter carbinolicus DSM 2380]
77545436|gb|ABA88998.1| Flp pilus assembly protein TadD contains TPR repeats-like [Pelobacter carbinolicus DSM 2380]
378 ref PAAYNNIGYLYMTQGNWDKAERSFRKALELNPVF
9030320890303208|gb|EAS32839.1 | hypothetical protein CIMG_03863 [Coccidioides immitis RS] 378 gb PDALFLRGRLFYLQGDNEQAIKHFKRALSLDPDS
8929188389291883|gb|EAR89871.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 378 gb SVAYNNIGLIYLRQNMLDEALEQFNKAIEADPEY
7869505078695050|ref|ZP_00859562.1 | TPR repeat [Bradyrhizobium sp. BTAi1]
78516724|gb|EAP30023.1| TPR repeat [Bradyrhizobium sp. BTAi1]
378 ref FGSYNNLGVAYQALGRFEEATAAFEKALELAPDD
1632970816329708|ref|NP_440436.1 | hypothetical protein slr2048 [Synechocystis sp. PCC 6803]
1652192|dbj|BAA17116.1| slr2048 [Synechocystis sp. PCC 6803]
377 ref AELFGSMGYLYARQGQFAEASRSFQQALRVNPNN
2122845021228450|ref|NP_634372.1 | O-linked N-acetylglucosamine transferase [Methanosarcina mazei Go1]
20906930|gb|AAM32044.1| O-linked N-acetylglucosamine transferase [Methanosarcina mazei Go1]
377 ref ADLWNNMAFSYSQIGEYEKAVEAYGKALDLKPDY
7819831978198319|gb|ABB36084.1 | hypothetical protein Syncc9605_2352 [Synechococcus sp. CC9605]
78213860|ref|YP_382639.1| hypothetical protein Syncc9605_2352 [Synechococcus sp. CC9605]
377 gb ALAWYNLGLMQRRRGDLAAALEAYGRALALDPNN
5368849853688498|ref|ZP_00110359.2 | COG0457: FOG: TPR repeat [Nostoc punctiforme PCC 73102] 377 ref ANAYFNLAIALQQQGQTEQAIATYRQALQLDPQN
8928435589284355|gb|EAR82404.1 | SLEI family protein [Tetrahymena thermophila SB210] 377 gb AVAYNNMGLVYFRQNIDDQALEYFNKALEVNPKY
8928435489284354|gb|EAR82403.1 | SLEI family protein [Tetrahymena thermophila SB210] 377 gb AVAYNNMGLVYFRQNIDDQALEYFNKALEVNPKY
8928423089284230|gb|EAR82286.1 | SLEI family protein [Tetrahymena thermophila SB210] 377 gb IDAHIELGNIYLDKHDNDQALECYKRALEINPKE
8860220488602204|ref|YP_502382.1 | TPR repeat [Methanospirillum hungatei JF-1]
88187666|gb|ABD40663.1| TPR repeat [Methanospirillum hungatei JF-1]
376 ref DQGWYNLGNVLYAMKSYNESIEAYRKAVQLNPDN
6847596368475963|ref|XP_717922.1 | putative anaphase promoting complex TPR repeat subunit Cdc27 [Candida albicans SC5314]
46439658|gb|EAK98973.1| potential anaphase promoting complex TPR repeat subunit Cdc27 [Candida albicans SC5314]
376 ref YNALYGLGMIYINLGDYEKADYHFRKAISINPIN
6847609468476094|ref|XP_717856.1 | putative anaphase promoting complex TPR repeat subunit Cdc27 [Candida albicans SC5314]
46439590|gb|EAK98906.1| potential anaphase promoting complex TPR repeat subunit Cdc27 [Candida albicans SC5314]
376 ref YNALYGLGMIYINLGDYEKADYHFRKAISINPIN
1502654015026540|gb|AAK81379.1 | TPR-repeat-containing protein [Clostridium acetobutylicum ATCC 824]
15896690|ref|NP_350039.1| TPR-repeat-containing protein [Clostridium acetobutylicum ATCC 824]
376 gb ERAYYGLATIYDEKEDYEEAIKLYNKAIYINPNY
9057546090575460|ref|ZP_01231944.1 | hypothetical protein CdifQ_02001223 [Clostridium difficile QCD-32g58] 376 ref SDAYNLRGVIFMSKSEFNKARESYNKALELNPDN
9120385791203857|emb|CAJ71510.1 | similar to O-linked GlcNAc transferase [Candidatus Kuenenia stuttgartiensis] 376 emb SKIHFNLGLAYANKDMFSEAIAAFKKALSIDPEN
8929703289297032|gb|EAR95020.1 | TPR Domain containing protein [Tetrahymena thermophila SB210] 376 gb INSLYNLGNTYEDKEQLDEAISYYQRIIQIDPQN
8929359989293599|gb|EAR91587.1 | DNA polymerase family B containing protein [Tetrahymena thermophila SB210] 376 gb SYALTNLGFIYYLQGDYSKAISFYQQSIEIDPSM
8860287788602877|ref|YP_503055.1 | Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
88188339|gb|ABD41336.1| Tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
375 ref EKAWSSRGYAYVMEKNYNDALDSFEEALKINPGN
7239756372397563|gb|AAZ71836.1 | hypothetical protein Mbar_A2941 [Methanosarcina barkeri str. fusaro]
73670401|ref|YP_306416.1| hypothetical protein Mbar_A2941 [Methanosarcina barkeri str. fusaro]
375 gb AYAWNGKGNALYRLGRYDEALQAYDKAIAINPNY